Product Browser

Last updated: 2014/4/14
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

GST tag monoclonal antibody, clone S2

  • Catalog # : MAB0042-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against GST recombinant protein.
  • Immunogen:
  • GST tag. MW of the GST tag is 26 KDa.
  • Sequence:
  • MESPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLEDPGYRGRTSFV
  • Host:
  • Mouse
  • Isotype:
  • IgG1
  • Quality Control Testing:
  • Antibody Reactive Against GST on ELISA and Western Blot.

    QC Testing of MAB0042-M02
    Western Blot detection against Immunogen (25.63 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Recombinant protein)
  • Application Image
  • Western Blot (Recombinant protein)
  • RSS
  • YouTube
  • Linkedin
  • Facebook