HHIP monoclonal antibody (M01), clone 5D11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HHIP.
Immunogen
HHIP (NP_071920, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HHIP monoclonal antibody (M01), clone 5D11 Western Blot analysis of HHIP expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
HHIP monoclonal antibody (M01), clone 5D11. Western Blot analysis of HHIP expression in MCF-7 ( Cat # L046V1 ).Western Blot (Transfected lysate)
Western Blot analysis of HHIP expression in transfected 293T cell line by HHIP monoclonal antibody (M01), clone 5D11.
Lane 1: HHIP transfected lysate(78.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HHIP on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of HHIP transfected lysate using anti-HHIP monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HHIP MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HHIP is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — HHIP
Entrez GeneID
64399GeneBank Accession#
NM_022475Protein Accession#
NP_071920Gene Name
HHIP
Gene Alias
FLJ20992, FLJ90230, HIP, STQTL12
Gene Description
hedgehog interacting protein
Omim ID
606178Gene Ontology
HyperlinkGene Summary
This gene encodes a protein similar to the mouse hedgehog-interacting protein, a regulatory component of the hedgehog signalling pathway. Members of the hedgehog family are evolutionarily conserved proteins which are involved in many fundamental processes in embryonic development, including anteroposterior patterns of limbs and regulation of left-right asymmetry. [provided by RefSeq
Other Designations
hedgehog-interacting protein
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Role of hedgehog signaling in malignant pleural mesothelioma.
Shi Y, Moura U, Opitz I, Soltermann A, Rehrauer H, Thies S, Weder W, Stahel RA, Felley-Bosco E.
Clinical Cancer Research 2012 Sep; 18(17):4646.
Application:IHC-P, Human, Human nontumoral pleural tissue and mesothelioma tumors.
-
Role of hedgehog signaling in malignant pleural mesothelioma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com