TRIB3 monoclonal antibody (M03), clone 1H2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of TRIB3 expression in transfected 293T cell line by TRIB3 monoclonal antibody (M03), clone 1H2.
Lane 1: TRIB3 transfected lysate(39.6 KDa).
Lane 2: Non-transfected lysate.
RNAi Knockdown (Antibody validated)
Western blot analysis of TRIB3 over-expressed 293 cell line, cotransfected with TRIB3 Validated Chimera RNAi ( Cat # H00057761-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TRIB3 monoclonal antibody (M03) clone 1H2 (Cat # H00057761-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Immunofluorescence
Immunofluorescence of monoclonal antibody to TRIB3 on A-431 cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (35.53 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TRIB3.
Immunogen
TRIB3 (AAH27484, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PDRATAVATASRLGPYVLLEPEEGGRAYRALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHVARPTEVLAGTQLLYAFFTRTHGDMH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (73); Rat (73)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TRIB3 expression in transfected 293T cell line by TRIB3 monoclonal antibody (M03), clone 1H2.
Lane 1: TRIB3 transfected lysate(39.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of TRIB3 over-expressed 293 cell line, cotransfected with TRIB3 Validated Chimera RNAi ( Cat # H00057761-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TRIB3 monoclonal antibody (M03) clone 1H2 (Cat # H00057761-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to TRIB3 on A-431 cell. [antibody concentration 10 ug/ml] -
Gene Info — TRIB3
Entrez GeneID
57761GeneBank Accession#
BC027484Protein Accession#
AAH27484Gene Name
TRIB3
Gene Alias
C20orf97, NIPK, SINK, SKIP3, TRB3
Gene Description
tribbles homolog 3 (Drosophila)
Omim ID
607898Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1. [provided by RefSeq
Other Designations
neuronal cell death inducible putative kinase|p65-interacting inhibitor of NF-kappaB|tribbles 3
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com