PCDHB10 monoclonal antibody (M07), clone 4C4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PCDHB10.
Immunogen
PCDHB10 (NP_061753, 27 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GSGFGRYSVTEETEKGSFVVNLAKDLGLAEGELAARGTRVVSDDNKQYLLLDSHTGNLLTNEKLDREKLCGPKEPCMLYFQILMDDPFQIYRAELRVRD
Host
Mouse
Reactivity
Human, Mouse
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PCDHB10 monoclonal antibody (M07), clone 4C4 Western Blot analysis of PCDHB10 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Recombinant protein)
ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PCDHB10 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PCDHB10
Entrez GeneID
56126GeneBank Accession#
NM_018930Protein Accession#
NP_061753Gene Name
PCDHB10
Gene Alias
PCDH-BETA10, PCHB10
Gene Description
protocadherin beta 10
Omim ID
606336Gene Ontology
HyperlinkGene Summary
This gene is a member of the protocadherin beta gene cluster, one of three related gene clusters tandemly linked on chromosome five. The gene clusters demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The beta cluster contains 16 genes and 3 pseudogenes, each encoding 6 extracellular cadherin domains and a cytoplasmic tail that deviates from others in the cadherin superfamily. The extracellular domains interact in a homophilic manner to specify differential cell-cell connections. Unlike the alpha and gamma clusters, the transcripts from these genes are made up of only one large exon, not sharing common 3' exons as expected. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins. Their specific functions are unknown but they most likely play a critical role in the establishment and function of specific cell-cell neural connections. [provided by RefSeq
Other Designations
-
-
Interactome
-
Publication Reference
-
Gene expression profiling-based identification of cell-surface targets for developing multimeric ligands in pancreatic cancer.
Balagurunathan Y, Morse DL, Hostetter G, Shanmugam V, Stafford P, Shack S, Pearson J, Trissal M, Demeure MJ, Von Hoff DD, Hruby VJ, Gillies RJ, Han H.
Molecular Cancer Therapeutics 2008 Sep; 7(9):3071.
Application:IHC-P, Human, Human pancreatic cancer.
-
Gene expression profiling-based identification of cell-surface targets for developing multimeric ligands in pancreatic cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com