DCP1A monoclonal antibody (M06), clone 3G4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant DCP1A.
Immunogen
DCP1A (NP_060873, 186 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
STQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89); Rat (87)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DCP1A is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to DCP1A on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — DCP1A
Entrez GeneID
55802GeneBank Accession#
NM_018403Protein Accession#
NP_060873Gene Name
DCP1A
Gene Alias
FLJ21691, HSA275986, Nbla00360, SMAD4IP1, SMIF
Gene Description
DCP1 decapping enzyme homolog A (S. cerevisiae)
Omim ID
607010Gene Ontology
HyperlinkGene Summary
Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway. [provided by RefSeq
Other Designations
DCP1 decapping enzyme homolog A|Smad4-interacting transcriptional co-activator|decapping enzyme hDcp1a|putative protein product of Nbla00360|transcription factor SMIF
-
Interactomes
-
Pathways
-
Diseases
-
Publication Reference
-
The association of UBAP2L and G3BP1 mediated by small nucleolar RNA is essential for stress granule formation.
Eri Asano-Inami, Akira Yokoi, Mai Sugiyama, Toshinori Hyodo, Tomonari Hamaguchi, Hiroaki Kajiyama.
Communications Biology 2023 Apr; 6(1):415.
Application:IF, Human, HeLa cells.
-
The proteome and transcriptome of stress granules and P bodies during human T lymphocyte activation.
Nicolas Curdy, Olivia Lanvin, Juan-Pablo Cerapio, Fréderic Pont, Marie Tosolini, Emeline Sarot, Carine Valle, Nathalie Saint-Laurent, Emeline Lhuillier, Camille Laurent, Jean-Jacques Fournié, Don-Marc Franchini.
Cell Reports 2023 Mar; 42(3):112211.
Application:IF, WB-Ce, Human, Human T cell.
-
FUS ALS neurons activate major stress pathways and reduce translation as an early protective mechanism against neurodegeneration.
Barbara Szewczyk, René Günther, Julia Japtok, Moritz J Frech, Marcel Naumann, Hyun O Lee, Andreas Hermann.
Cell Reports 2023 Jan; 42(2):112025.
Application:IF, Human, hiPSCs.
-
Ubiquitination and deubiquitination of 4E-T regulate neural progenitor cell maintenance and neurogenesis by controlling P-body formation.
Shreeya Kedia, Mohamad-Reza Aghanoori, Kaylan M L Burns, Maneesha Subha, Laura Williams, Pengqiang Wen, Drayden Kopp, Sarah L Erickson, Emily M Harvey, Xin Chen, Michelle Hua, Jose Uriel Perez, Fatin Ishraque, Guang Yang.
Cell Reports 2022 Jul; 40(2):111070.
Application:IF, Human, mouse, HEK293 cells, primary neural stem/progenitor cells (NPCs) .
-
The Parkinson's disease protein alpha-synuclein is a modulator of processing bodies and mRNA stability.
Erinc Hallacli, Can Kayatekin, Sumaiya Nazeen, Xiou H Wang, Zoe Sheinkopf, Shubhangi Sathyakumar, Souvarish Sarkar, Xin Jiang, Xianjun Dong, Roberto Di Maio, Wen Wang, Matthew T Keeney, Daniel Felsky, Jackson Sandoe, Aazam Vahdatshoar, Namrata D Udeshi, D R Mani, Steven A Carr, Susan Lindquist, Philip L De Jager, David P Bartel, Chad L Myers, J Timothy Greenamyre, Mel B Feany, Shamil R Sunyaev, Chee Yeun Chung, Vikram Khurana.
Cell 2022 Jun; 185(12):2035.
Application:WB-Ce, Human, HEK 293T cells, Human neurons.
-
Nucleocytoplasmic transport of the RNA-binding protein CELF2 regulates neural stem cell fates.
Melissa J MacPherson, Sarah L Erickson, Drayden Kopp, Pengqiang Wen, Mohamad-Reza Aghanoori, Shreeya Kedia, Kaylan M L Burns, Antonio Vitobello, Frederic Tran Mau-Them, Quentin Thomas, Nina B Gold, William Brucker, Louise Amlie-Wolf, Karen W Gripp, Olaf Bodamer, Laurence Faivre, Mikko Muona, Lara Menzies, Julia Baptista, Katie Guegan, Alison Male, Xing-Chang Wei, Guiqiong He, Quan Long, A Micheil Innes, Guang Yang.
Cell Reports 2021 Jun; 35(10):109226.
Application:IF, PLA-Ce, Human, Human cortical cells.
-
Inherited deficiency of stress granule ZNFX1 in patients with monocytosis and mycobacterial disease.
Tom Le Voyer, Anna-Lena Neehus, Rui Yang, Masato Ogishi, Jérémie Rosain, Fayhan Alroqi, Maha Alshalan, Sophie Blumental, Fatima Al Ali, Taushif Khan, Manar Ata, Laurence Rozen, Anne Demulder, Paul Bastard, Conor Gruber, Manon Roynard, Yoann Seeleuthener, Franck Rapaport, Benedetta Bigio, Maya Chrabieh, Danielle Sng, Laureline Berteloot, Nathalie Boddaert, Flore Rozenberg, Saleh Al-Muhsen, Aida Bertoli-Avella, Laurent Abel, Dusan Bogunovic, Nico Marr, Davood Mansouri, Fuad Al Mutairi, Vivien Bézi
PNAS 2021 Apr; 118(15):e210280411.
Application:IF, Human, A-549 cells.
-
CLUH granules coordinate translation of mitochondrial proteins with mTORC1 signaling and mitophagy.
Pla-Martín D, Schatton D, Wiederstein JL, Marx MC, Khiati S, Krüger M, Rugarli EI.
The EMBO Journal 2020 Mar; e102731.
Application:IF, Mouse, Mouse hepatocytes, Mouse livers.
-
Single-Cell Analysis of Multiple Steps of Dynamic NF-κB Regulation in Interleukin-1α-Triggered Tumor Cells Using Proximity Ligation Assays.
Mayr-Buro C, Schlereth E, Beuerlein K, Tenekeci U, Meier-Soelch J, Schmitz ML, Kracht M.
Cancers 2019 Aug; 11(8):E1199.
Application:PLA-Ce, WB, Human, HeLa cells.
-
Reactivation of nonsense-mediated mRNA decay protects against C9orf72 dipeptide-repeat neurotoxicity.
Xu W, Bao P, Jiang X, Wang H, Qin M, Wang R, Wang T, Yang Y, Lorenzini I, Liao L, Sattler R, Xu J.
Brain 2019 May; 142(5):1349.
Application:IF, WB, Mouse, Mouse brains.
-
MOV10 sequesters the RNP of influenza A virus in the cytoplasm and is antagonized by viral NS1 protein.
Li J, Hu S, Xu F, Mei S, Liu X, Yin L, Zhao F, Zhao X, Sun H, Xiong Z, Zhang D, Cen S, Wang J, Liang C, Guo F.
The Biochemical Journal 2019 Jan; 476(3):467.
Application:IF, Human, A-549 cells.
-
ES-mediated chimera analysis revealed requirement of DDX6 for NANOS2 localization and function in mouse germ cells.
Shimada R, Kiso M, Saga Y.
Scientific Reports 2019 Jan; 9(1):515.
Application:IS, Mouse, Germ cells.
-
FAM98A is localized to stress granules and associates with multiple stress granule-localized proteins.
Ozeki K, Sugiyama M, Akter KA, Nishiwaki K, Asano-Inami E, Senga T.
Molecular and Cellular Biochemistry 2017 Jul; [Epub].
Application:IF, Human, HeLa cells.
-
Intracellular signalling pathways and cytoskeletal functions converge on the psoriasis candidate gene CCHCR1 expressed at P-bodies and centrosomes.
Tervaniemi MH, Katayama S, Skoog T, Siitonen HA, Vuola J, Nuutila K, Tammimies K, Suomela S, Kankuri E, Kere J, Elomaa O.
BMC Genomics 2018 Jun; 19(1):432.
Application:IF, Human, HEK 293 cells.
-
A Smaug2-Based Translational Repression Complex Determines the Balance between Precursor Maintenance versus Differentiation during Mammalian Neurogenesis.
Amadei G, Zander MA, Yang G, Dumelie JG, Vessey JP, Lipshitz HD, Smibert CA, Kaplan DR, Miller FD.
The Journal of Neuroscience 2015 Nov; 35(47):15666.
Application:IF, Mouse, E12.5 CD1 cortical cells.
-
Host cytoplasmic processing bodies assembled by Trypanosoma cruzi during infection exert anti-parasitic activity.
Seto E, Onizuka Y, Nakajima-Shimada J.
Parasitology International 2015 Dec; 64(6):540.
Application:IF, Human, HT1080 cells.
-
Hepatitis C virus infection inhibits P-body granule formation in human livers.
Perez-Vilaro G, Fernandez-Carrillo C, Mensa L, Miquel R, Sanjuan X, Forns X, Perez-Del-Pulgar S, Diez J.
Journal of Hepatology 2015 Apr; 62(4):785.
Application:IF, Human, Liver.
-
CCHCR1 interacts with EDC4, suggesting its localization in P-bodies.
Ling YH, Wong CC, Li KW, Chan KM, Boukamp P, Liu WK.
Experimental Cell Research 2014 Sep; 327(1):12.
Application:IF, Human, HeLa cells.
-
Processing bodies accumulate in human cytomegalovirus-infected cells and do not affect viral replication at high multiplicity of infection.
Seto E, Inoue T, Nakatani Y, Yamada M, Isomura H.
Virology 2014 Jun; 458:151.
Application:IF, WB-Tr, Human, HFF cells.
-
5-Fluorouracil affects assembly of stress granules based on RNA incorporation.
Kaehler C, Isensee J, Hucho T, Lehrach H, Krobitsch S.
Nucleic Acids Research 2014 Jun; 42(10):6436.
Application:IF, Human, HeLa cells.
-
hnRNP L and NF90 interact with hepatitis C virus 5' terminal untranslated RNA and promote efficient replication.
Li Y, Masaki T, Shimakami T, Lemon SM.
Journal of Virology 2014 Jul; 88(13):7199.
Application:IP-WB, Human, Huh7.5 cells.
-
C9orf72 nucleotide repeat structures initiate molecular cascades of disease.
Haeusler AR, Donnelly CJ, Periz G, Simko EA, Shaw PG, Kim MS, Maragakis NJ, Troncoso JC, Pandey A, Sattler R, Rothstein JD, Wang J.
Nature 2014 Mar; 507(7491):195.
Application:IF, Human, iPS neuron cells.
-
Multiple mechanisms repress N-Bak mRNA translation in the healthy and apoptotic neurons.
Jakobson M, Jakobson M, Llano O, Palgi J, Arumäe U.
Cell Death & Disease 2013 Aug; 4:e777.
Application:IS, Mouse, Superior cervical ganglion neurons.
-
Zinc-finger antiviral protein mediates retinoic acid inducible gene I-like receptor-independent antiviral response to murine leukemia virus.
Lee H, Komano J, Saitoh Y, Yamaoka S, Kozaki T, Misawa T, Takahama M, Satoh T, Takeuchi O, Yamamoto N, Matsuura Y, Saitoh T, Akira S.
PNAS 2013 Jul; 110(30):12379.
Application:IF, Human, HEK 293T cells.
-
Identification and analysis of a novel dimerization domain shared by various members of JNK scaffold proteins.
Cohen-Katsenelson K, Wasserman T, Darlyuk-Saadon I, Rabner A, Glaser F, Aronheim A.
The Journal of Biological Chemistry 2013 Jan; 288(10):7294.
Application:IF, Human, HEK-293.
-
Pdc1 Functions in the Assembly of P Bodies in Schizosaccharomyces pombe.
Wang CY, Chen WL, Wang SW.
Molecular and Cellular Biology 2013 Mar; 33(6):1244.
Application:WB,IFA, Human, Hela cells.
-
Identification of DEAD-box RNA Helicase 6 (DDX6) as a Cellular Modulator of Vascular Endothelial Growth Factor Expression under Hypoxia.
de Vries S, Naarmann-de Vries IS, Urlaub H, Lue H, Bernhagen J, Ostareck DH, Ostareck-Lederer A.
The Journal of Biological Chemistry 2013 Feb; 288(8):5815.
Application:IF, Human, MCF-7 cells.
-
The P Body Protein Dcp1a Is Hyper-phosphorylated during Mitosis.
Aizer A, Kafri P, Kalo A, Shav-Tal Y.
PLoS One 2013 Jan; 8(1):e49783.
Application:WB, IF, Human, U2OS cell.
-
BUHO: A MATLAB Script for the Study of Stress Granules and Processing Bodies by High-Throughput Image Analysis.
Perez-Pepe M, Slomiansky V, Loschi M, Luchelli L, Neme M, Thomas MG, Boccaccio GL.
PLoS One 2012 Dec; 7(12):e51495.
Application:IF, Human, Fruit fly, U2OS cells, Drosophila processing bodies.
-
Competing and noncompeting activities of miR-122 and the 5' exonuclease Xrn1 in regulation of hepatitis C virus replication.
Li Y, Masaki T, Yamane D, McGivern DR, Lemon SM.
PNAS 2012 Dec; 110(5):1881.
Application:IF, Human, Huh-7.5 cell.
-
The NS1 protein of influenza A virus interacts with cellular processing bodies and stress granules through RNA-associated protein 55 (RAP55) during virus infection.
Mok BW, Song W, Wang P, Tai H, Chen Y, Zheng M, Wen X, Lau SY, Wu WL, Matsumoto K, Yuen KY, Chen H.
Journal of Virology 2012 Dec; 86(23):12695.
Application:IF, Human, HEK 293T cells.
-
LSm14A is a processing body-associated sensor of viral nucleic acids that initiates cellular antiviral response in the early phase of viral infection.
Li Y, Chen R, Zhou Q, Xu Z, Li C, Wang S, Mao A, Zhang X, He W, Shu HB.
PNAS 2012 Jul; 109(29):11770.
Application:IF, WB, Human, HCT-116 cells.
-
A monoclonal antibody against p53 cross-reacts with processing bodies.
Thomas MG, Luchelli L, Pascual M, Gottifredi V, Boccaccio GL.
PLoS One 2012 May; 7(5):e36447.
Application:IF, Rat, Rat neurons.
-
PKCα binds G3BP2 and regulates stress granule formation following cellular stress.
Kobayashi T, Winslow S, Sunesson L, Hellman U, Larsson C.
PLoS One 2012 Apr; 7(4):e35820.
Application:IF, Human, SK-N-BE(2)C cells.
-
Identification of the P-body component PATL1 as a novel ALG-2-interacting protein by in silico and far-Western screening of proline-rich proteins.
Osugi K, Suzuki H, Nomura T, Ariumi Y, Shibata H, Maki M.
Journal of Biochemistry 2012 Jun; 151(6):657.
Application:IF, Human, HeLa cells.
-
Smaug1 mRNA-silencing foci respond to NMDA and modulate synapse formation.
Baez MV, Luchelli L, Maschi D, Habif M, Pascual M, Thomas MG, Boccaccio GL.
Journal of Cellular Biology 2011 Dec; 195(7):1141.
Application:IF, Human, Rat, Rat neurons, U2OS cells.
-
The DEAD-box RNA Helicase DDX6 is Required for Efficient Encapsidation of a Retroviral Genome.
Yu SF, Lujan P, Jackson DL, Emerman M, Linial ML.
PLoS Pathogens 2011 Oct; 7(10):e1002303.
Application:IF, WB, Human, HT1080, 293T cells.
-
c-Jun N-terminal kinase phosphorylates DCP1a to control formation of P bodies.
Rzeczkowski K, Beuerlein K, Muller H, Dittrich-Breiholz O, Schneider H, Kettner-Buhrow D, Holtmann H, Kracht M.
The Journal of Cell Biology 2011 Aug; 194(4):581.
Application:WB-Ce, Human, HEK293IL-1R cells.
-
Differential utilization of decapping enzymes in mammalian mRNA decay pathways.
Li Y, Song M, Kiledjian M.
RNA 2011 Mar; 17(3):419.
Application:IF, Mouse, MEF cells.
-
NANOS2 interacts with the CCR4-NOT deadenylation complex and leads to suppression of specific RNAs.
Suzuki A, Igarashi K, Aisaki KI, Kanno J, Saga Y.
PNAS 2010 Feb; 107(8):3594.
Application:IF, IHC, Mouse, Mouse gonadal sections.
-
Cytoplasmic Compartmentalization of the Fetal piRNA Pathway in Mice.
Aravin AA, van der Heijden GW, Castaneda J, Vagin VV, Hannon GJ, Bortvin A.
PLoS Genetics 2009 Dec; 5(12):e1000764.
Application:IF, IHC, Mouse, Mouse testis.
-
A novel c-Jun N-terminal kinase (JNK)-binding protein WDR62 is recruited to stress granules and mediates a nonclassical JNK activation.
Wasserman T, Katsenelson K, Daniliuc S, Hasin T, Choder M, Aronheim A.
Molecular Biology of the Cell 2009 Nov; 21(1).
Application:IF, Human, HEK 293T cells.
-
A large ribonucleoprotein particle induced by cytoplasmic PrP shares striking similarities with the chromatoid body, an RNA granule predicted to function in posttranscriptional gene regulation.
Beaudoin S, Vanderperre B, Grenier C, Tremblay I, Leduc F, Roucou X.
Biochimica et Biophysica Acta 2008 Oct; 1793(2):335.
Application:WB-Ti, Mouse, N2a cells.
-
The Dynamics of Mammalian P Body Transport, Assembly and Disassembly In Vivo.
Aizer A, Brody Y, Ler LW, Sonenberg N, Singer RH, Shav-Tal Y.
Molecular Biology of the Cell 2008 Jul; 19(10):4154.
Application:IF, Human, U2OS cells.
-
The association of UBAP2L and G3BP1 mediated by small nucleolar RNA is essential for stress granule formation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com