- World's Largest Antibody and Recombinant Protein Manufacturer
- | Home
- | Contact Us
- Products
- Services
- Support
- Connection
- About us
 |
 |
-
- DNA & RNA (46)
- siRNA/Chimera (15364)
- Proteins/Peptides (25865)
- MaxPab® Ab (16217)
- Monoclonal Ab (21396)
- Polyclonal Ab (27483)
- Conjugate Ab/Beads (1328)
- Secondary/Tag Ab (1005)
- Lysates/Slides (9167)
- Ab Pairs/Kits (7698)
- Ab Array Det Kits (1)
- Ab Concentration Kits (1)
- Ab Labeling Kits (40)
- Ab Pairs for ELISA (1352)
- Ab Pairs for IP-WB (2015)
- Ab Pairs for PP (259)
- Ab Pairs for PPI (606)
- Ab Purification Kits (3)
- Assay Kits (521)
- Cell-Based ELISA Kits (708)
- CLIA Kits (44)
- ELISA Kits (2113)
- IHC Kits (6)
- IP & ChIP Kits (20)
- Mutation Detection Kits (3)
- Protein Expression Kits (6)
- Ab & Tissue Arrays (128)
- IHC/Pathology Ab (17916)
- In Situ Hybridization (1056)
- Circulating Tumor Cell (29)
- Systems (4)
- ASR/IVDiagnostics (21)
- Related Product Showcase
- By Research Area
 |
|
Click this icon to add products to compare list. Select up to 10 products.
- Home > Products > Monoclonal Ab > Human > Apoptosis > BFAR monoclonal antibody (M01), clone 1C6
BFAR monoclonal antibody (M01), clone 1C6
- Catalog # : H00051283-M01
- Visit Frequency :
- Size
- Price
- In Stock
- Availability
- Cart
- 50 ug
- USD $ 319
- order now, ship next day
-
-
- The price is valid only in USA. Please select country.
- Ask us anything
- Payment Information
Credit card :
or Purchase Order Number
Email : sales@abnova.com
Phone : +1-909-992-0619 (new)
Fax : +1-909-992-3401- Products will be shipped directly to the customer.
- Specification
- Product Description:
- Mouse monoclonal antibody raised against a partial recombinant BFAR.
- Immunogen:
- BFAR (AAH03054, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Sequence:
- LRFEDIQQNNDIVQSLAAFQKYGNDQIPLAPNTGRANQQMGGGFFSGVLTALTGVAVVLLVYHWSSRESEHDLLVHKAVAKWTAEEVVLWLEQLGPWASL
- Host:
- Mouse
- Reactivity:
- Human
- Isotype:
- IgG2a kappa
- Quality Control Testing:
- Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
- Storage Buffer:
- In 1x PBS, pH 7.2
- Storage Instruction:
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- MSDS:
Download
- Applications
- Western Blot (Transfected lysate)
- Western Blot analysis of BFAR expression in transfected 293T cell line by BFAR monoclonal antibody (M01), clone 1C6.
Lane 1: BFAR transfected lysate(52.7 KDa).
Lane 2: Non-transfected lysate. - Protocol Download
- Western Blot (Recombinant protein)
- Protocol Download
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
enlarge this image- Immunoperoxidase of monoclonal antibody to BFAR on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
- Protocol Download
- RNAi Knockdown (Antibody validated)
- Western blot analysis of BFAR over-expressed 293 cell line, cotransfected with BFAR Validated Chimera RNAi ( Cat # H00051283-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with BFAR monoclonal antibody (M01), clone 1C6 (Cat # H00051283-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
- Protocol Download
- Related Disease
