GOLM1 monoclonal antibody (M06), clone 5B10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GOLM1.
Immunogen
GOLM1 (NP_057632, 302 a.a. ~ 401 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of GOLM1 expression in transfected 293T cell line by GOLM1 monoclonal antibody (M06), clone 5B10.
Lane 1: GOLM1 transfected lysate(45.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to GOLM1 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GOLM1 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to GOLM1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — GOLM1
Entrez GeneID
51280GeneBank Accession#
NM_016548Protein Accession#
NP_057632Gene Name
GOLM1
Gene Alias
C9orf155, FLJ22634, FLJ23608, GOLPH2, GP73, PSEC0257, bA379P1.3
Gene Description
golgi membrane protein 1
Omim ID
606804Gene Ontology
HyperlinkGene Summary
The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi transmembrane protein. It processes proteins synthesized in the rough endoplasmic reticulum and assists in the transport of protein cargo through the Golgi apparatus. The expression of this gene has been observed to be upregulated in response to viral infection. Alternatively spliced transcript variants encoding the same protein have been described for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000021587|golgi membrane protein GP73|golgi phosphoprotein 2|golgi protein, 73-kD
-
Interactome
-
Disease
-
Publication Reference
-
Therapeutic Targeting of Golgi Phosphoprotein 2 (GOLPH2) with Armed Antibodies: A Preclinical Study of Anti-GOLPH2 Antibody Drug Conjugates in Lung and Colorectal Cancer Models of Patient Derived Xenografts (PDX).
Liewen H, Markuly N, Läubli H, Liu Y, Matter MS, Liewen N, Renner C, Zippelius A, Stenner F.
Targeted Oncology 2019 Oct; 14(5):577.
Application:IHC, IF, Human, PLCPRF5, HuH7, HCT-116, H1975, Lovo cells, Colorectal cancer.
-
Role of the AP-5 adaptor protein complex in late endosome-to-Golgi retrieval.
Hirst J, Itzhak DN, Antrobus R, Borner GHH, Robinson MS.
PLoS Biology 2018 Jan; 16(1):e2004411.
Application:IF, WB, Human, HeLa cells.
-
The HOPE fixation technique - a promising alternative to common prostate cancer biobanking approaches.
Braun M, Menon R, Nikolov P, Kirsten R, Petersen K, Schilling D, Schott C, Gundisch S, Fend F, Becker KF, Perner S.
BMC Cancer 2011 Dec; 11:511.
Application:IHC, WB, Human, Benign and cancerous prostatic tissues.
-
ERG rearrangement in small cell prostatic and lung cancer.
Scheble VJ, Braun M, Wilbertz T, Stiedl AC, Petersen K, Schilling D, Reischl M, Seitz G, Fend F, Kristiansen G, Perner S.
Histopathology 2010 Jun; 56(7):937.
Application:IHC, Human, Small cell prostatic cancer (SCPC), small cell lung cancer (SCLC).
-
GOLPH2 protein expression as a novel tissue biomarker for prostate cancer: implications for tissue-based diagnostics.
Kristiansen G, Fritzsche FR, Wassermann K, Jager C, Tolls A, Lein M, Stephan C, Jung K, Pilarsky C, Dietel M, Moch H.
British Journal of Cancer 2008 Sep; 99(6):939.
Application:IHC, IF, Human, Prostate tissues.
-
GOLPH2 and MYO6: putative prostate cancer markers localized to the Golgi apparatus.
Wei S, Dunn TA, Isaacs WB, De Marzo AM, Luo J.
Prostate 2008 Sep; 68(13):1387.
Application:IF, IHC-P, Human, Human prostate cancer.
-
Therapeutic Targeting of Golgi Phosphoprotein 2 (GOLPH2) with Armed Antibodies: A Preclinical Study of Anti-GOLPH2 Antibody Drug Conjugates in Lung and Colorectal Cancer Models of Patient Derived Xenografts (PDX).
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com