GOLM1 monoclonal antibody (M04), clone 3B10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GOLM1.
Immunogen
GOLM1 (NP_057632, 302 a.a. ~ 401 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of GOLM1 expression in transfected 293T cell line by GOLPH2 monoclonal antibody (M04), clone 3B10.
Lane 1: GOLM1 transfected lysate(45.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of GOLM1 transfected lysate using anti-GOLM1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GOLM1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GOLM1 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — GOLM1
Entrez GeneID
51280GeneBank Accession#
NM_016548Protein Accession#
NP_057632Gene Name
GOLM1
Gene Alias
C9orf155, FLJ22634, FLJ23608, GOLPH2, GP73, PSEC0257, bA379P1.3
Gene Description
golgi membrane protein 1
Omim ID
606804Gene Ontology
HyperlinkGene Summary
The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi transmembrane protein. It processes proteins synthesized in the rough endoplasmic reticulum and assists in the transport of protein cargo through the Golgi apparatus. The expression of this gene has been observed to be upregulated in response to viral infection. Alternatively spliced transcript variants encoding the same protein have been described for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000021587|golgi membrane protein GP73|golgi phosphoprotein 2|golgi protein, 73-kD
-
Interactome
-
Disease
-
Publication Reference
-
Knockdown of Golgi phosphoprotein 73 blocks the trafficking of matrix metalloproteinase-2 in hepatocellular carcinoma cells and inhibits cell invasion.
Liu Y, Zhang X, Zhou S, Shi J, Xu Y, He J, Lin F, Wei A, Zhou L, Chen Z.
Journal of Cellular and Molecular Medicine 2019 Apr; 23(4):2399.
Application:WB, Human, HepG2, Huh7, PLC5, MHCC-97 H cells.
-
Knockdown of Golgi phosphoprotein 73 blocks the trafficking of matrix metalloproteinase-2 in hepatocellular carcinoma cells and inhibits cell invasion.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com