Product Browser
 
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

SS18L2 MaxPab mouse polyclonal antibody (B03)   MaxPab

  • Catalog # : H00051188-B03
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 50 uL
  • USD $ 319
  • Stock Image
  • order now, ship next day
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human SS18L2 protein.
  • Immunogen:
  • SS18L2 (AAH17804.1, 1 a.a. ~ 77 a.a) full-length human protein.
  • Sequence:
  • MSVAFVPDWLRGKAEVNQETIQRLLEENDQLIRCIVEYLNKGRGNECVQYQHVLHRNLIYLATIADASPTSTSKAME
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SS18L2 expression in transfected 293T cell line (H00051188-T03) by SS18L2 MaxPab polyclonal antibody.

    Lane 1: SS18L2 transfected lysate(8.58 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Gene Name:
  • SS18L2
  • Gene Alias:
  • KIAA-iso
  • Gene Description:
  • synovial sarcoma translocation gene on chromosome 18-like 2
  • Gene Summary:
  • Synovial sarcomas occur most frequently in the extremities around large joints. More than 90% of cases have a recurrent and specific chromosomal translocation, t(X;18)(p11.2;q11.2), in which the 5-prime end of the SS18 gene (MIM 600192) is fused in-frame to the 3-prime end of the SSX1 (MIM 312820), SSX2 (MIM 300192), or SSX4 (MIM 300326) gene. The SS18L2 gene is homologous to SS18.[supplied by OMIM
  • Other Designations:
  • SYT homolog 2
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!