Product Browser

Last updated: 2014/10/20
  • Related Product Showcase
  • By Research Area

  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NDUFA13 MaxPab mouse polyclonal antibody (B02)MaxPab

  • Catalog # : H00051079-B02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human NDUFA13 protein.
  • Immunogen:
  • NDUFA13 (AAH09189.1, 1 a.a. ~ 144 a.a) full-length human protein.
  • Sequence:
  • MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • NDUFA13 MaxPab polyclonal antibody. Western Blot analysis of NDUFA13 expression in human liver.
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of NDUFA13 expression in transfected 293T cell line (H00051079-T02) by NDUFA13 MaxPab polyclonal antibody.

    Lane 1: NDUFA13 transfected lysate(15.84 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlargeenlarge this image
  • Immunoperoxidase of purified MaxPab antibody to NDUFA13 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Gene Name:
  • NDUFA13
  • Gene Alias:
  • B16.6,CDA016,CGI-39,GRIM-19,GRIM19
  • Gene Description:
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13
  • Other Designations:
  • cell death-regulatory protein GRIM19
  • RSS
  • YouTube
  • Linkedin
  • Facebook