IL17C MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of IL17C expression in transfected 293T cell line (H00027189-T01) by IL17C MaxPab polyclonal antibody.
Lane 1: IL17C transfected lysate(21.8 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of IL17C transfected lysate using anti-IL17C MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with IL17C MaxPab mouse polyclonal antibody (B01) (H00027189-B01).
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to IL17C on HeLa cell. [antibody concentration 30 ug/ml]
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human IL17C protein.
Immunogen
IL17C (NP_037410.1, 1 a.a. ~ 197 a.a) full-length human protein.
Sequence
MTLLPGLLFLTWLHTCLAHHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHTEFIHVPVGCTCVLPRSV
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Rat (75)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of IL17C expression in transfected 293T cell line (H00027189-T01) by IL17C MaxPab polyclonal antibody.
Lane 1: IL17C transfected lysate(21.8 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of IL17C transfected lysate using anti-IL17C MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with IL17C MaxPab mouse polyclonal antibody (B01) (H00027189-B01).Immunofluorescence
Immunofluorescence of purified MaxPab antibody to IL17C on HeLa cell. [antibody concentration 30 ug/ml] -
Gene Info — IL17C
Entrez GeneID
27189GeneBank Accession#
NM_013278Protein Accession#
NP_037410.1Gene Name
IL17C
Gene Alias
CX2, IL-17C, IL-21, MGC126884, MGC138401
Gene Description
interleukin 17C
Omim ID
604628Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a T cell-derived cytokine that shares the sequence similarity with IL17. This cytokine was reported to stimulate the release of tumor necrosis factor alpha and interleukin 1 beta from a monocytic cell line. The expression of this cytokine was found to be restricted to activated T cells. [provided by RefSeq
Other Designations
cytokine CX2
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com