CLEC4E monoclonal antibody (M08), clone 2D12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a full length recombinant CLEC4E.
Immunogen
CLEC4E (AAH00715, 1 a.a. ~ 219 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFITRCVVTFRIFQTCDEKKFQLPENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGINPLNKGKSL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (66); Rat (67)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (49.83 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CLEC4E monoclonal antibody (M08), clone 2D12. Western Blot analysis of CLEC4E expression in K-562.Western Blot (Recombinant protein)
ELISA
-
Gene Info — CLEC4E
Entrez GeneID
26253GeneBank Accession#
BC000715Protein Accession#
AAH00715Gene Name
CLEC4E
Gene Alias
CLECSF9, MINCLE
Gene Description
C-type lectin domain family 4, member E
Omim ID
609962Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein is a downstream target of CCAAT/enhancer binding protein (C/EBP), beta (CEBPB) and may play a role in inflammation. Alternative splice variants have been described but their full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq
Other Designations
C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 9|macrophage-inducible C-type lectin
-
Interactomes
-
Publication Reference
-
Toll like-receptor agonist Pam3Cys modulates the immunogenicity of liposomes containing the tuberculosis vaccine candidate H56.
Kennerknecht K, Noschka R, Löffler F, Wehrstedt S, Pedersen GK, Mayer D, Grieshober M, Christensen D, Stenger S.
Medical Microbiology and Immunology 2020 Apr; 209(2):163.
Application:Flow Cyt, Human, Macrophages, Monocytes.
-
The protective effect of inflammatory monocytes during systemic C. albicans infection is dependent on collaboration between C-type lectin-like receptors.
Thompson A, Davies LC, Liao CT, da Fonseca DM, Griffiths JS, Andrews R, Jones AV, Clement M, Brown GD, Humphreys IR, Taylor PR, Orr SJ.
PLoS Pathogens 2019 Jun; 15(6):e1007850.
Application:Flow Cyt, Mouse, Neutrophils, Monocytes/macrophages.
-
Mycobacterial cord factor enhances migration of neutrophil-like HL-60 cells by prolonging AKT phosphorylation.
Lee WB, Yan JJ, Kang JS, Chung S, Kim LK.
Microbiology and Immunology 2017 Nov; 61(12):523.
Application:Flow Cyt, Human, HL-60 cells.
-
Mincle and human B cell function.
Kawata K, Illarionov P, Yang GX, Kenny TP, Zhang W, Tsuda M, Ando Y, Leung PS, Ansari AA, Eric Gershwin M.
Journal of Autoimmunity 2012 Dec; 39(4):315.
Application:Flow Cyt, Human, PBMCs.
-
Human and mouse macrophage-inducible C-type lectin (Mincle) bind Candida albicans.
Bugarcic A, Hitchens K, Beckhouse AG, Wells CA, Ashman RB, Blanchard H.
Glycobiology 2008 May; 18(9):679.
Application:EPair-Re, Human, Mouse, Recombinant protein.
-
Toll like-receptor agonist Pam3Cys modulates the immunogenicity of liposomes containing the tuberculosis vaccine candidate H56.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com