RASD2 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human RASD2 full-length ORF ( AAH13419, 1 a.a. - 266 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MMKTLSSGNCTLSVPAKNSYRMVVLGASRVGKSSIGSRFLNGRFEDQYTPTIEDFHRKVYNIRGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHGELCRQVPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRKISVQYGDAFHPRPFCMRRVKEMDAYGMVSPFARRPSVNSDLKYIKAKVLREGQARERDKCTIQ
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
55
Interspecies Antigen Sequence
Mouse (95); Rat (95)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — RASD2
Entrez GeneID
23551GeneBank Accession#
BC013419Protein Accession#
AAH13419Gene Name
RASD2
Gene Alias
MGC:4834, Rhes, TEM2
Gene Description
RASD family, member 2
Gene Ontology
HyperlinkGene Summary
This gene encodes a Ras-related protein that enriched in striatum. The product of this gene binds to GTP and possesses intrinsic GTPase activity. The gene belongs to the Ras superfamily of small GTPases. The exact function of this gene is unknown, but most striatum-specific mRNAs characterized to date encode components of signal transduction cascades. [provided by RefSeq
Other Designations
GTP-binding protein Rhes|Ras homolog enriched in striatum|tumor endothelial marker 2
-
Disease
-
Publication Reference
-
Ontogeny and dopaminergic regulation in brain of Ras homolog enriched in striatum (Rhes).
Harrison LM, Lahoste GJ, Ruskin DN.
Brain Research 2008 Oct; 1245:16.
Application:WB, Recombinant protein.
-
Ontogeny and dopaminergic regulation in brain of Ras homolog enriched in striatum (Rhes).
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com