QPRT monoclonal antibody (M01), clone 5D11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant QPRT.
Immunogen
QPRT (NP_055113, 198 a.a. ~ 297 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALDFSLKLFAKEVAPVPKIH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84); Rat (82)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
QPRT monoclonal antibody (M01), clone 5D11 Western Blot analysis of QPRT expression in HepG2 ( Cat # L019V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to QPRT on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged QPRT is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — QPRT
Entrez GeneID
23475GeneBank Accession#
NM_014298Protein Accession#
NP_055113Gene Name
QPRT
Gene Alias
QPRTase
Gene Description
quinolinate phosphoribosyltransferase
Omim ID
606248Gene Ontology
HyperlinkGene Summary
This gene encodes a key enzyme in catabolism of quinolinate, an intermediate in the tryptophan-nicotinamide adenine dinucleotide pathway. Quinolinate acts as a most potent endogenous exitotoxin to neurons. Elevation of quinolinate levels in the brain has been linked to the pathogenesis of neurodegenerative disorders such as epilepsy, Alzheimer's disease, and Huntington's disease. [provided by RefSeq
Other Designations
nicotinate-nucleotide pyrophosphorylase (carboxylating)
-
Interactome
-
Pathway
-
Publication Reference
-
Kynurenine Pathway Modulation Reverses the Experimental Autoimmune Encephalomyelitis Mouse Disease Progression.
Gayathri Sundaram, Chai K Lim, Bruce J Brew, Gilles J Guillemin.
Journal of Neuroinflammation 2020 Jun; 17(1):176.
Application:IHC-P, Mouse, Spinal cord.
-
Anti-apoptotic quinolinate phosphoribosyltransferase (QPRT) is a target gene of Wilms' tumor gene 1 (WT1) protein in leukemic cells.
Ullmark T, Montano G, Järvstråt L, Jernmark Nilsson H, Håkansson E, Drott K, Nilsson B, Vidovic K, Gullberg U.
Biochemical and Biophysical Research Communications 2016 Nov; 482(4):802.
Application:WB, Human, K-562 cells.
-
QPRT: a potential marker for follicular thyroid carcinoma including minimal invasive variant; a gene expression, RNA and immunohistochemical study.
Hinsch N, Frank M, Doring C, Vorlander C, Hansmann ML.
BMC Cancer 2009 Mar; 9:93.
Application:IHC-P, WB-Ti, Human, Human follicular thyroid carcinoma.
-
Kynurenine Pathway Modulation Reverses the Experimental Autoimmune Encephalomyelitis Mouse Disease Progression.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com