Product Browser

Last updated: 2014/10/20
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RPP40 MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00010799-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human RPP40 protein.
  • Immunogen:
  • RPP40 (AAH17871.1, 1 a.a. ~ 244 a.a) full-length human protein.
  • Sequence:
  • MNTGPYYFVKNLPLHELITPEFISTFIKKGKLILSLDKDTYEETGLQGHPSQFSGRKIMKFIVSIDLMELSLNLDSKKYERISWSFKEKKPLKFDFLLAWHKTGSEESTMMSYFSKYQIQEHQPKVALSTLRDLQCPVLQSSELEGTPEVSCRALELFDWLGAVFSNVDLNNEPNNFISTYCCPEPSTVVAKAYLCTITGFILPEKICLLLEHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • RPP40 MaxPab polyclonal antibody. Western Blot analysis of RPP40 expression in human kidney.
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of RPP40 expression in transfected 293T cell line (H00010799-T01) by RPP40 MaxPab polyclonal antibody.

    Lane 1: RPP40 transfected lysate(26.84 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Gene Name:
  • RPP40
  • Gene Alias:
  • RNASEP1,bA428J1.3
  • Gene Description:
  • ribonuclease P/MRP 40kDa subunit
  • Other Designations:
  • ribonuclease P (40 kD),ribonuclease P 40kDa subunit,ribonuclease P, 40kD subunit,ribonuclease P1
  • RSS
  • YouTube
  • Linkedin
  • Facebook