HYOU1 monoclonal antibody (M01), clone 6F7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HYOU1.
Immunogen
HYOU1 (NP_006380, 901 a.a. ~ 999 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EVQYLLNKAKFTKPRPRPKDKNGTRAEPPLNASASDQGEKVIPPAGQTEDAEPISEPEKVETGSEPGDTEPLELGGPGAEPEQKEQSTGQKRPLKNDEL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (93)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HYOU1 monoclonal antibody (M01), clone 6F7 Western Blot analysis of HYOU1 expression in MCF-7 ( Cat # L046V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HYOU1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HYOU1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — HYOU1
Entrez GeneID
10525GeneBank Accession#
NM_006389Protein Accession#
NP_006380Gene Name
HYOU1
Gene Alias
DKFZp686N08236, FLJ94899, FLJ97572, Grp170, HSP12A, ORP150
Gene Description
hypoxia up-regulated 1
Omim ID
601746Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the heat shock protein 70 family. This gene uses alternative transcription start sites. A cis-acting segment found in the 5' UTR is involved in stress-dependent induction, resulting in the accumulation of this protein in the endoplasmic reticulum (ER) under hypoxic conditions. The protein encoded by this gene is thought to play an important role in protein folding and secretion in the ER. Since suppression of the protein is associated with accelerated apoptosis, it is also suggested to have an important cytoprotective role in hypoxia-induced cellular perturbation. This protein has been shown to be up-regulated in tumors, especially in breast tumors, and thus it is associated with tumor invasiveness. This gene also has an alternative translation initiation site, resulting in a protein that lacks the N-terminal signal peptide. This signal peptide-lacking protein, which is only 3 amino acids shorter than the mature protein in the ER, is thought to have a housekeeping function in the cytosol. In rat, this protein localizes to both the ER by a carboxy-terminal peptide sequence and to mitochondria by an amino-terminal targeting signal. [provided by RefSeq
Other Designations
150 kDa oxygen-regulated protein|glucose-regulated protein 170|oxygen regulated protein (150kD)
-
Interactome
-
Disease
-
Publication Reference
-
Limited expression of reticulocalbin-1 in lymphatic endothelial cells in lung tumor but not in normal lung.
Yoshida Y, Yamashita T, Nagano K, Imai S, Nabeshi H, Yoshikawa T, Yoshioka Y, Abe Y, Kamada H, Tsutsumi Y, Tsunoda SI.
Biochemical and Biophysical Research Communications 2011 Feb; 405(4):610.
Application:IHC, Tissue Microarray, Human, Lung.
-
Proteinuria and Hyperglycemia Induce Endoplasmic Reticulum Stress.
Lindenmeyer MT, Rastaldi MP, Ikehata M, Neusser MA, Kretzler M, Cohen CD, Schlondorff D.
Journal of the American Society of Nephrology 2008 Sep; 19(11):2225.
Application:IF, Human, Normal kidneys or from patients with established diabetic nephropathy (DN) or minimal-change disease (MCD).
-
Mechanism of cancer cell adaptation to metabolic stress: proteomics identification of a novel thyroid hormone mediated gastric carcinogenic signaling pathway.
Liu R, Li Z, Bai S, Zhang H, Tang M, Lei Y, Chen L, Liang S, Zhao YL, Wei Y, Huang C.
Molecular & Cellular Proteomics 2008 Aug; 8(1):70.
Application:WB-Ti, Human, Human gastric cancer.
-
Limited expression of reticulocalbin-1 in lymphatic endothelial cells in lung tumor but not in normal lung.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com