GPNMB monoclonal antibody (M01), clone 1A8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GPNMB is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GPNMB.
Immunogen
GPNMB (NP_001005340, 104 a.a. ~ 203 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSEDSDGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLGQYFQKLGRCSVRVSVNTANVTL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (70); Rat (69)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GPNMB is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — GPNMB
Entrez GeneID
10457GeneBank Accession#
NM_001005340Protein Accession#
NP_001005340Gene Name
GPNMB
Gene Alias
HGFIN, NMB
Gene Description
glycoprotein (transmembrane) nmb
Omim ID
604368Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB may be involved in growth delay and reduction of metastatic potential. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
glycoprotein NMB|glycoprotein nmb-like protein|osteoactivin|transmembrane glycoprotein
-
Interactome
-
Disease
-
Publication Reference
-
GPNMB/OA protein increases the invasiveness of human metastatic prostate cancer cell lines DU145 and PC3 through MMP-2 and MMP-9 activity.
Fiorentini C, Bodei S, Bedussi F, Fragni M, Bonini SA, Simeone C, Zani D, Berruti A, Missale C, Memo M, Spano P, Sigala S.
Experimental Cell Research 2014 Apr; 323(1):100.
Application：WB-Tr, Human, DU145, PC3 cells.
-
Bioinformatic and statistical analysis of the optic nerve head in a primate model of ocular hypertension.
Kompass KS, Agapova OA, Li W, Kaufman PL, Rasmussen CA, Hernandez MR.
BMC Neuroscience 2008 Sep; 9:93.
Application：IF, IHC, Monkey, Optic nerve head containing retina and myelinated nerve from cynomolgus macaques.
-
GPNMB/OA protein increases the invasiveness of human metastatic prostate cancer cell lines DU145 and PC3 through MMP-2 and MMP-9 activity.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com