Product Browser
 
  • Related Product Showcase
  • By Research Area
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

SEMA3A polyclonal antibody (A01)   

  • Catalog # : H00010371-A01
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 50 uL
  • USD $ 229
  • Stock Image
  • order now, ship next day
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SEMA3A.
  • Immunogen:
  • SEMA3A (NP_006071, 672 a.a. ~ 770 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • HLEELLHKDDDGDGSKTKEMSNSMTPSQKVWYRDFMQLINHPNLNTMDEFCEQVWKRDRKQRRQRPGHTPGNSNKWKHLQENKKGRNRRTHEFERAPRS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010371-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • SEMA3A
  • Gene Alias:
  • Hsema-I,Hsema-III,MGC133243,SEMA1,SEMAD,SEMAIII,SEMAL,SemD,coll-1
  • Gene Description:
  • sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3A
  • Gene Summary:
  • This gene is a member of the semaphorin family and encodes a protein with an Ig-like C2-type (immunoglobulin-like) domain, a PSI domain and a Sema domain. This secreted protein can function as either a chemorepulsive agent, inhibiting axonal outgrowth, or as a chemoattractive agent, stimulating the growth of apical dendrites. In both cases, the protein is vital for normal neuronal pattern development. Increased expression of this protein is associated with schizophrenia and is seen in a variety of human tumor cell lines. Also, aberrant release of this protein is associated with the progression of Alzheimer's disease. [provided by RefSeq
  • Other Designations:
  • collapsin 1,semaphorin 3A,semaphorin D,semaphorin III,semaphorin L,semaphorin-like
  • Gene Pathway
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!