ABCF2 monoclonal antibody (M01), clone 1D11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ABCF2.
Immunogen
ABCF2 (AAH01661, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNS
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ABCF2 monoclonal antibody (M01), clone 1D11 Western Blot analysis of ABCF2 expression in Hela ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of ABCF2 expression in transfected 293T cell line by ABCF2 monoclonal antibody (M01), clone 1D11.
Lane 1: ABCF2 transfected lysate(68.53 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ABCF2 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of ABCF2 transfected lysate using anti-ABCF2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ABCF2 monoclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ABCF2 is approximately 0.3ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of ABCF2 over-expressed 293 cell line, cotransfected with ABCF2 Validated Chimera RNAi ( Cat # H00010061-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ABCF2 monoclonal antibody (M01), clone 1D11 (Cat # H00010061-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — ABCF2
Entrez GeneID
10061GeneBank Accession#
BC001661Protein Accession#
AAH01661Gene Name
ABCF2
Gene Alias
ABC28, DKFZp586K1823, EST133090, HUSSY-18, HUSSY18, M-ABC1
Gene Description
ATP-binding cassette, sub-family F (GCN20), member 2
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This protein is a member of the GCN20 subfamily. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq
Other Designations
ABC-type transport protein|ATP-binding cassette, sub-family F, member 2|Iron inhibited ABC transporter 2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com