PPM1F monoclonal antibody (M01), clone 2A9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PPM1F.
Immunogen
PPM1F (NP_055449, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSSGAPQKSSPMASGAEETPGFLDTLLQDFPALLNPEDPLPWKAPGTVLSQEEVEGELAELAMGFLGSRKAPPPLAAALAHEAVSQLLQTDLSEFRKLPR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (79); Rat (79)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PPM1F monoclonal antibody (M01), clone 2A9 Western Blot analysis of PPM1F expression in Jurkat ( Cat # L017V1 ).Western Blot (Transfected lysate)
Western Blot analysis of PPM1F expression in transfected 293T cell line by PPM1F monoclonal antibody (M01), clone 2A9.
Lane 1: PPM1F transfected lysate(49.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PPM1F is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — PPM1F
Entrez GeneID
9647GeneBank Accession#
NM_014634Protein Accession#
NP_055449Gene Name
PPM1F
Gene Alias
CaMKPase, FEM-2, KIAA0015, POPX2, hFEM-2
Gene Description
protein phosphatase 1F (PP2C domain containing)
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase can interact with Rho guanine nucleotide exchange factors (PIX), and thus block the effects of p21-activated kinase 1 (PAK), a protein kinase mediating biological effects downstream of Rho GTPases. Calcium/calmodulin-dependent protein kinase II gamma (CAMK2G/CAMK-II) is found to be one of the substrates of this phosphatase. The overexpression of this phosphatase or CAMK2G has been shown to mediate caspase-dependent apoptosis. An alternatively spliced transcript variant has been identified, but its full-length nature has not been determined. [provided by RefSeq
Other Designations
Ca(2+)/calmodulin-dependent protein kinase phosphatase|CaM-kinase phosphatase|PP2C phosphatase|partner of PIX 2|protein phosphatase 1F
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com