Product Browser

Last updated: 2014/12/14
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPM1F polyclonal antibody (A01)

  • Catalog # : H00009647-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PPM1F.
  • Immunogen:
  • PPM1F (NP_055449, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MSSGAPQKSSPMASGAEETPGFLDTLLQDFPALLNPEDPLPWKAPGTVLSQEEVEGELAELAMGFLGSRKAPPPLAAALAHEAVSQLLQTDLSEFRKLPR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009647-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • PPM1F polyclonal antibody (A01), Lot # 051024JC01 Western Blot analysis of PPM1F expression in K-562 ( Cat # L009V1 ).
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9647
  • Gene Name:
  • PPM1F
  • Gene Alias:
  • CaMKPase,FEM-2,KIAA0015,POPX2,hFEM-2
  • Gene Description:
  • protein phosphatase 1F (PP2C domain containing)
  • Gene Summary:
  • The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase can interact with Rho guanine nucleotide exchange factors (PIX), and thus block the effects of p21-activated kinase 1 (PAK), a protein kinase mediating biological effects downstream of Rho GTPases. Calcium/calmodulin-dependent protein kinase II gamma (CAMK2G/CAMK-II) is found to be one of the substrates of this phosphatase. The overexpression of this phosphatase or CAMK2G has been shown to mediate caspase-dependent apoptosis. An alternatively spliced transcript variant has been identified, but its full-length nature has not been determined. [provided by RefSeq
  • Other Designations:
  • Ca(2+)/calmodulin-dependent protein kinase phosphatase,CaM-kinase phosphatase,PP2C phosphatase,partner of PIX 2,protein phosphatase 1F
  • RSS
  • YouTube
  • Linkedin
  • Facebook