CXCL14 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CXCL14 full-length ORF ( AAH03513, 1 a.a. - 111 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.95
Interspecies Antigen Sequence
Mouse (94); Rat (95)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CXCL14
Entrez GeneID
9547GeneBank Accession#
BC003513Protein Accession#
AAH03513Gene Name
CXCL14
Gene Alias
BMAC, BRAK, KS1, Kec, MGC10687, MIP-2g, NJAC, SCYB14, bolekine
Gene Description
chemokine (C-X-C motif) ligand 14
Omim ID
604186Gene Ontology
HyperlinkGene Summary
This gene belongs to the cytokine gene family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes but not for lymphocytes, dendritic cells, neutrophils or macrophages. It has been implicated that this cytokine is involved in the homeostasis of monocyte-derived macrophages rather than in inflammation. [provided by RefSeq
Other Designations
CXC chemokine in breast and kidney|small inducible cytokine B14|small inducible cytokine subfamily B (Cys-X-Cys), member 14 (BRAK)
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
The role of CXCL chemokine family in the development and progression of gastric cancer.
Chen X, Chen R, Jin R, Huang Z.
International Journal of Clinical and Experimental Pathology 2020 Mar; 13(3):484.
Application:Quant, Human, Human plasma.
-
The role of CXCL chemokine family in the development and progression of gastric cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com