Product Browser

Last updated: 2014/7/21

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CYTH3 (Human) Recombinant Protein (P01)

  • Catalog # : H00009265-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CYTH3 full-length ORF (AAH08191.1, 1 a.a. - 179 a.a.) recombinant protein with GST tag at N-terminal.
  • Sequence:
  • MNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 45.43
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue

    QC Testing of H00009265-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9265
  • Gene Name:
  • CYTH3
  • Gene Alias:
  • ARNO3,GRP1,PSCD3
  • Gene Description:
  • cytohesin 3
  • Gene Summary:
  • This gene encodes a member of the PSCD (pleckstrin homology, Sec7 and coiled-coil domains) family. PSCD family members have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. This encoded protein is involved in the control of Golgi structure and function, and it may have a physiological role in regulating ADP-ribosylation factor protein 6 (ARF) functions, in addition to acting on ARF1. [provided by RefSeq
  • Other Designations:
  • ARF nucleotide-binding site opener 3,general receptor of phosphoinositides 1,pleckstrin homology, Sec7 and coiled-coil domains 3,pleckstrin homology, Sec7 and coiled/coil domains 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook