Product Browser

Last updated: 2014/10/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

APLN (Human) Recombinant Protein (P02)

  • Catalog # : H00008862-P02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human APLN full-length ORF ( AAH21104, 1 a.a. - 77 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 34.1
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008862-P02
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8862
  • Gene Name:
  • APLN
  • Gene Alias:
  • XNPEP2
  • Gene Description:
  • apelin
  • Gene Summary:
  • Apelin is a neuropeptide expressed in the supraoptic and paraventricular nuclei that acts on specific receptors located on vasopressinergic neurons (De Mota et al., 2004) [PubMed 15231996].[supplied by OMIM
  • Other Designations:
  • apelin, AGTRL1 ligand,peptide ligand for APJ receptor
  • RSS
  • YouTube
  • Linkedin
  • Facebook