Product Browser

Last updated: 2014/8/25
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SEMA3B polyclonal antibody (A01)

  • Catalog # : H00007869-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SEMA3B.
  • Immunogen:
  • SEMA3B (NP_004627, 651 a.a. ~ 748 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • FTQPLRRLSLHVLSATQAERLARAEEAAPAAPPGPKLWYRDFLQLVEPGGGGSANSLRMCRPQPALQSLPLESRRKGRNRRTHAPEPRAERGPRSATH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007869-A01
    Western Blot detection against Immunogen (10.89 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7869
  • Gene Name:
  • SEMA3B
  • Gene Alias:
  • FLJ34863,LUCA-1,SEMA5,SEMAA,SemA,semaV
  • Gene Description:
  • sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B
  • Gene Summary:
  • The semaphorin/collapsin family of molecules plays a critical role in the guidance of growth cones during neuronal development. The secreted protein encoded by this gene family member is important in axonal guidance and has been shown to act as a tumor suppressor by inducing apoptosis. [provided by RefSeq
  • Other Designations:
  • semaphorin 3B,semaphorin A,semaphorin V
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook