Product Browser

Last updated: 2014/8/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TRPC1 monoclonal antibody (M03A), clone 1E4

  • Catalog # : H00007220-M03A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant TRPC1.
  • Immunogen:
  • TRPC1 (NP_003295, 442 a.a. ~ 505 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • AHNKFHDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007220-M03A
    Western Blot detection against Immunogen (32.78 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7220
  • Gene Name:
  • TRPC1
  • Gene Alias:
  • HTRP-1,MGC133334,MGC133335,TRP1
  • Gene Description:
  • transient receptor potential cation channel, subfamily C, member 1
  • Other Designations:
  • transient receptor potential channel 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook