STAT3 monoclonal antibody (M02), clone 4D6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant STAT3.
Immunogen
STAT3 (NP_003141, 670 a.a. ~ 769 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LVYLYPDIPKEEAFGKYCRPESQEHPEADPGAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
STAT3 monoclonal antibody (M02), clone 4D6 Western Blot analysis of STAT3 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STAT3 is approximately 0.1ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between NFKB1 and STAT3. HeLa cells were stained with anti-NFKB1 rabbit purified polyclonal 1:1200 and anti-STAT3 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to STAT3 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — STAT3
Entrez GeneID
6774GeneBank Accession#
NM_003150Protein Accession#
NP_003141Gene Name
STAT3
Gene Alias
APRF, FLJ20882, HIES, MGC16063
Gene Description
signal transducer and activator of transcription 3 (acute-phase response factor)
Omim ID
102582Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. Three alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq
Other Designations
DNA-binding protein APRF|acute-phase response factor|signal transducer and activator of transcription 3
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
EPHA3 regulates the multidrug resistance of small cell lung cancer via the PI3K/BMX/STAT3 sign.
Peng J, Wang Q, Liu H, Ye M, Wu X, Guo L.
Tumour Biology 2016 Sep; 37(9):11959.
Application:WB-Tr, Human, H69, H69AR, H446, H146, H1688 cells.
-
Acetylation Directs Survivin Nuclear Localization to Repress STAT3 Oncogenic Activity.
Wang H, Holloway MP, Ma L, Cooper ZA, Riolo M, Samkari A, Elenitoba-Johnson KS, Chin YE, Altura RA.
The Journal of Biological Chemistry 2010 Sep; 285(46):36129.
Application:IF, Human, HeLa cells.
-
EPHA3 regulates the multidrug resistance of small cell lung cancer via the PI3K/BMX/STAT3 sign.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com