ST13 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ST13 full-length ORF ( AAH15317, 1 a.a. - 58 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MLFKSFKNTHHINLHLSLCVLLLMCRVLLSRNCQCVLGLTQEQFLLDSLFDLFNLIIF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
32.12
Interspecies Antigen Sequence
Mouse (93); Rat (92)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ST13
Entrez GeneID
6767GeneBank Accession#
BC015317Protein Accession#
AAH15317Gene Name
ST13
Gene Alias
AAG2, FAM10A1, FAM10A4, FLJ27260, HIP, HOP, HSPABP, HSPABP1, MGC129952, P48, PRO0786, SNC6
Gene Description
suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein)
Omim ID
606796Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an adaptor protein that mediates the association of the heat shock proteins HSP70 and HSP90. This protein has been shown to be involved in the assembly process of glucocorticoid receptor, which requires the assistance of multiple molecular chaperones. The expression of this gene is reported to be downregulated in colorectal carcinoma tissue suggesting that is a candidate tumor suppressor gene. [provided by RefSeq
Other Designations
Hsp70-interacting protein|OTTHUMP00000028873|aging-associated protein 2|heat shock 70kD protein binding protein|progesterone receptor-associated p48 protein|putative tumor suppressor ST13
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com