SSTR2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SSTR2 partial ORF ( AAH19610, 1 a.a. - 60 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCG
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
32.23
Interspecies Antigen Sequence
Mouse (73); Rat (68)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SSTR2
Entrez GeneID
6752GeneBank Accession#
BC019610Protein Accession#
AAH19610Gene Name
SSTR2
Gene Alias
-
Gene Description
somatostatin receptor 2
Omim ID
182452Gene Ontology
HyperlinkGene Summary
Somatostatin acts at many sites to inhibit the release of many hormones and other secretory proteins. The biologic effects of somatostatin are probably mediated by a family of G protein-coupled receptors that are expressed in a tissue-specific manner. SSTR2 is a member of the superfamily of receptors having seven transmembrane segments and is expressed in highest levels in cerebrum and kidney. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
A freeze-dried kit formulation for the preparation of Lys(27)(99mTc-EDDA/HYNIC)-Exendin(9-39)/99mTc-EDDA/HYNIC-Tyr3-Octreotide to detect benign and malignant insulinomas.
Veronica Medina-García, Blanca E Ocampo-García, Guillermina Ferro-Flores, Clara L Santos-Cuevas, Liliana Aranda-Lara, Rocio García-Becerra, David Ordaz-Rosado, Laura Melendez-Alafort.
Nuclear Medicine and Biology 2015 Dec; 42(12):911.
Application:RIA, Recombinant protein.
-
A freeze-dried kit formulation for the preparation of Lys(27)(99mTc-EDDA/HYNIC)-Exendin(9-39)/99mTc-EDDA/HYNIC-Tyr3-Octreotide to detect benign and malignant insulinomas.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com