SPINK1 monoclonal antibody (M01), clone 4D4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SPINK1.
Immunogen
SPINK1 (AAH25790, 24 a.a. ~ 79 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (68)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (31.9 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SPINK1 monoclonal antibody (M01), clone 4D4. Western Blot analysis of SPINK1 expression in human pancreas.Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SPINK1 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 1 ug/ml]Immunoprecipitation
Immunoprecipitation of SPINK1 transfected lysate using anti-SPINK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SPINK1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SPINK1 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — SPINK1
Entrez GeneID
6690GeneBank Accession#
BC025790Protein Accession#
AAH25790Gene Name
SPINK1
Gene Alias
PCTT, PSTI, Spink3, TATI
Gene Description
serine peptidase inhibitor, Kazal type 1
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. Mutations in this gene are associated with hereditary pancreatitis and tropical calcific pancreatitis. [provided by RefSeq
Other Designations
pancreatic secretory trypsin inhibitor|serine protease inhibitor, Kazal type 1|tumor-associated trypsin inhibitor
-
Interactome
-
Disease
-
Publication Reference
-
SPINK1-induced tumor plasticity provides a therapeutic window for chemotherapy in hepatocellular carcinoma.
Ki-Fong Man, Lei Zhou, Huajian Yu, Ka-Hei Lam, Wei Cheng, Jun Yu, Terence K Lee, Jing-Ping Yun, Xin-Yuan Guan, Ming Liu, Stephanie Ma.
Nature Communications 2023 Nov; 14(1):7863.
Application:WB, Co-IP, IHC-p, IF, Human, HCC tumors, Huh7,MHCC97L, .
-
The roles of mutated SPINK1 gene in prostate cancer cells.
Xiuyi Pan, Junya Tan, Xiaoxue Yin, Qianqi Liu, Linmao Zheng, Zhengzheng Su, Qiao Zhou, Ni Chen.
Mutagenesis 2022 Sep; geac019.
Application:IF, WB-Ce, Human, 22Rv1, C4-2B, CL-1, DU145, HKE293T, LNCaP, PC-3 cells.
-
Enhancement of gemcitabine efficacy by K73-03 via epigenetically regulation of miR-421/SPINK1 in gemcitabine resistant pancreatic cancer cells.
Abdullah Shopit, Xiaodong Li, Shisheng Wang, Mohammed Awsh, Mohammed Safi, Peng Chu, Jianlong Jia, Mohammed Al-Radhi, Salem Baldi, Fuhan Wang, Jiani Fang, Jinyong Peng, Xiaodong Ma, Zeyao Tang, Xiaohong Shu.
Phytomedicine 2021 Oct; 91:153711.
Application:WB-Ce, Human, AsPC-1, MIA PaCa-2 cells.
-
Transition zone prostate cancer is associated with better clinical outcomes than peripheral zone cancer.
Shun Sato, Takahiro Kimura, Hajime Onuma, Shin Egawa, Hiroyuki Takahashi.
BJUI Compass 2021 May; 2(3):169.
Application:IHC, Human, Human prostate cancer.
-
SPINK1 expression is enriched in African American prostate cancer but is not associated with altered immune infiltration or oncologic outcomes post-prostatectomy.
Faisal FA, Kaur HB, Tosoian JJ, Tomlins SA, Schaeffer EM, Lotan TL.
Prostate Cancer and Prostatic Diseases 2019 Mar; [Epub].
Application:IHC, Human, Human prostate cancer.
-
Clinical significance and EZH2, ERG and SPINK1 protein expression in pure and mixed ductal adenocarcinoma of the prostate.
Patil PA, McKenney JK, Reynolds JP, Przybycin CG, Magi-Galluzzi C.
Histology and Histopathology 2018 Sep; 18046.
Application:IHC-P, Human, Ductal adenocarcinoma with papillary and cribriform pattern.
-
Comparison of ERG and SPINK1 expression among incidental and metastatic prostate cancer in Japanese men.
Koide H, Kimura T, Inaba H, Sato S, Iwatani K, Yorozu T, Furusato B, Kamata Y, Miki J, Kiyota H, Takahashi H, Egawa S.
Prostate 2019 Jan; 79(1):3.
Application:IHC-P, Human, Prostate cancer.
-
Ductal adenocarcinoma of the prostate: Clinical and biological profiles.
Vinceneux A, Bruyère F, Haillot O, Charles T, de la Taille A, Salomon L, Allory Y, Ouzaid I, Choudat L, Rouprêt M, Comperat E, Houede N, Beauval JB, Vourc'h P, Fromont G.
Prostate 2017 Jul; 77(12):1242.
Application:IHC-P, Human, Human prostate cancer.
-
Serine peptidase inhibitor Kazal type 1 (SPINK1) as novel downstream effector of the cadherin-17/β-catenin axis in hepatocellular carcinoma.
Felix H Shek, Ruibang Luo, Brian Y H Lam, Wing Kin Sung, Tak-Wah Lam, John M Luk, Ming Sum Leung, Kin Tak Chan, Hector K Wang, Chung Man Chan, Ronnie T Poon, Nikki P Lee
Cellular Oncology (Dordrecht) 2017 Jun; 40(5):443.
Application:IHC, WB, Human, Human HCC tumor tissue, H2M, MHCC97-H(97H), MHCC97-L(97L), PLC/PRF/5.
-
Serine peptidase inhibitor Kazal type 1 (SPINK1) as novel downstream effector of the cadherin-17/β-catenin axis in hepatocellular carcinoma.
Felix H Shek, Ruibang Luo, Brian Y H Lam, Wing Kin Sung, Tak-Wah Lam, John M Luk, Ming Sum Leung, Kin Tak Chan, Hector K Wang, Chung Man Chan, Ronnie T Poon, Nikki P Lee
Cellular Oncology (Dordrecht) 2017 Jun; 40(5):443.
Application:IHC, WB, Human, Human HCC tumor tissue, H2M, MHCC97-H(97H), MHCC97-L(97L), PLC/PRF/5.
-
The construction and proliferative effects of a lentiviral vector capable of stably overexpressing SPINK1 gene in human pancreatic cancer AsPC-1 cell line.
Zhang J, Wang D, Hu N, Wang Q, Yu S, Wang J.
Tumour Biology 2016 May; 37(5):5847.
Application:WB, Human, AsPC-1 cells.
-
Molecular profiling of ETS and non-ETS aberrations in prostate cancer patients from northern India.
Ateeq B, Kunju LP, Carskadon SL, Pandey SK, Singh G, Pradeep I, Tandon V, Singhai A, Goel A, Amit S, Agarwal A, Dinda AK, Seth A, Tsodikov A, Chinnaiyan AM, Palanisamy N.
The Prostate 2015 Jul; 75(10):1051.
Application:IHC-P, Human, Prostate cancer.
-
Molecular profiling of ETS gene rearrangements in patients with prostate cancer registered in REDEEM clinical trial.
Palanisamy N, Tsodikov A, Yan W, Suleman K, Rittmaster R, Lucia SM, Chinnaiyan AM, Fleshner N, Kunju LP.
Urologic Oncology 2015 Mar; 33(3):108.e5.
Application:IHC, Human, Prostate biopsy samples.
-
HOXB13 G84E-related Familial Prostate Cancers: A Clinical, Histologic, and Molecular Survey.
Smith SC, Palanisamy N, Zuhlke KA, Johnson AM, Siddiqui J, Chinnaiyan AM, Kunju LP, Cooney KA, Tomlins SA.
The American Journal of Surgical Pathology 2014 May; 38(5):615.
Application:IHC, Human, Prostate adenocarcinoma.
-
Novel dual-color immunohistochemical methods for detecting ERG-PTEN and ERG-SPINK1 status in prostate carcinoma.
Bhalla R, Kunju LP, Tomlins SA, Christopherson K, Cortez C, Carskadon S, Siddiqui J, Park K, Miguel Mosquera J, Pestano GA, Rubin MA, Chinnaiyan AM, Palanisamy N.
Modern Pathology 2013 Jun; 26(6):835.
Application:IHC, Human, Human prostate cancer.
-
Loss of SPINK1 expression is associated with unfavorable outcomes in urothelial carcinoma of the bladder after radical cystectomy.
Rink M, Park K, Volkmer BG, Xylinas E, Hansen J, Cha EK, Robinson BD, Hautmann R, Küfer R, Engel O, Chun FK, Dahlem R, Rubin MA, Shariat SF, Mosquera JM.
Urologic Oncology 2013 Nov; 31(8):1716.
Application:IHC, Human, Benign urothelium and invasive urothelial carcinoma of the bladder.
-
325 DIFFERENCES IN TMPRSS2-ERG GENE FUSION AND SPINK1 OVEREXPRESSION IN PROSTATE CANCER IN AFRICAN-AMERICAN AND CAUCASIAN MEN.
Francesca Khani, Juan Miguel Mosquera, Kyung Park, Abhishek Srivastava, Ashutosh Tewari, Mark Rubin, Brian Robinson.
The Journal of Urology 2012 Apr; 187(4 Supplement):e132.
Application:IHC, Human, Prostate cancer.
-
Characterization of ETS gene aberrations in select histologic variants of prostate carcinoma.
Han B, Mehra R, Suleman K, Tomlins SA, Wang L, Singhal N, Linetzky KA, Palanisamy N, Zhou M, Chinnaiyan AM, Shah RB.
Modern Pathology 2009 Sep; 22(9):1176.
Application:IHC, Human, Prostate.
-
The role of SPINK1 in ETS rearrangement-negative prostate cancers.
Tomlins SA, Rhodes DR, Yu J, Varambally S, Mehra R, Perner S, Demichelis F, Helgeson BE, Laxman B, Morris DS, Cao Q, Cao X, Andren O, Fall K, Johnson L, Wei JT, Shah RB, Al-Ahmadie H, Eastham JA, Eggener SE, Fine SW, Hotakainen K, Stenman UH, Tsodikov A,.
Cancer Cell 2008 Jun; 13(6):519.
Application:IHC, Human, Human prostate cancer.
-
SPINK1-induced tumor plasticity provides a therapeutic window for chemotherapy in hepatocellular carcinoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com