Product Browser

Last updated: 2014/9/1
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC6A3 polyclonal antibody (A01)

  • Catalog # : H00006531-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SLC6A3.
  • Immunogen:
  • SLC6A3 (NP_001035, 161 a.a. ~ 237 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • AWALHYLFSSFTTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006531-A01
    Western Blot detection against Immunogen (34.58 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6531
  • Gene Name:
  • SLC6A3
  • Gene Alias:
  • DAT,DAT1
  • Gene Description:
  • solute carrier family 6 (neurotransmitter transporter, dopamine), member 3
  • Gene Summary:
  • The dopamine transporter (DAT1) mediates the active reuptake of dopamine from the synapse and is a principal regulator of dopaminergic neurotransmission. The DAT1 gene has been implicated in human disorders such as parkinsonism, Tourette syndrome, and substance abuse (Vandenbergh et al., 1992 [PubMed 1359373]).[supplied by OMIM
  • Other Designations:
  • dopamine transporter,variable number tandem repeat (VNTR)
  • Gene Pathway
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook