SGK monoclonal antibody (M01), clone 4D7-G3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SGK expression in transfected 293T cell line by SGK monoclonal antibody (M01), clone 4D7-G3.
Lane 1: SGK transfected lysate(48.9 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SGK on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SGK on formalin-fixed paraffin-embedded human stomach tissue. [antibody concentration 5 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SGK is approximately 1ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of SGK over-expressed 293 cell line, cotransfected with SGK Validated Chimera RNAi ( Cat # H00006446-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SGK monoclonal antibody (M01) clone 4D7-G3 (Cat # H00006446-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Immunofluorescence
Immunofluorescence of monoclonal antibody to SGK on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (73.04 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant SGK.
Immunogen
SGK (AAH01263.1, 1 a.a. ~ 431 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINWDDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLGFSYAPPTDSFL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (73.04 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SGK expression in transfected 293T cell line by SGK monoclonal antibody (M01), clone 4D7-G3.
Lane 1: SGK transfected lysate(48.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SGK on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SGK on formalin-fixed paraffin-embedded human stomach tissue. [antibody concentration 5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SGK is approximately 1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of SGK over-expressed 293 cell line, cotransfected with SGK Validated Chimera RNAi ( Cat # H00006446-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SGK monoclonal antibody (M01) clone 4D7-G3 (Cat # H00006446-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to SGK on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — SGK1
Entrez GeneID
6446GeneBank Accession#
BC001263Protein Accession#
AAH01263.1Gene Name
SGK1
Gene Alias
SGK
Gene Description
serum/glucocorticoid regulated kinase 1
Omim ID
602958Gene Ontology
HyperlinkGene Summary
This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels, suggesting an involvement in the regulation of processes such as cell survival, neuronal excitability, and renal sodium excretion. High levels of expression of this gene may contribute to conditions such as hypertension and diabetic nephropathy. Several alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000017247|serine/threonine protein kinase SGK
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com