SERPINB3 monoclonal antibody (M01), clone 2F5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SERPINB3 expression in transfected 293T cell line by SERPINB3 monoclonal antibody (M01), clone 2F5.
Lane 1: SERPINB3 transfected lysate(44.6 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of SERPINB3 transfected lysate using anti-SERPINB3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SERPINB3 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SERPINB3 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (38.39 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SERPINB3.
Immunogen
SERPINB3 (NP_008850, 276 a.a. ~ 390 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.39 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SERPINB3 expression in transfected 293T cell line by SERPINB3 monoclonal antibody (M01), clone 2F5.
Lane 1: SERPINB3 transfected lysate(44.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of SERPINB3 transfected lysate using anti-SERPINB3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SERPINB3 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SERPINB3 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — SERPINB3
Entrez GeneID
6317GeneBank Accession#
NM_006919Protein Accession#
NP_008850Gene Name
SERPINB3
Gene Alias
HsT1196, SCC, SCCA-1, SCCA-PD, SCCA1, T4-A
Gene Description
serpin peptidase inhibitor, clade B (ovalbumin), member 3
Omim ID
600517Gene Ontology
HyperlinkGene Summary
clade B (ovalbumin)
Other Designations
serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3|squamous cell carcinoma antigen 1
-
Interactome
-
Disease
-
Publication Reference
-
Label-Free Cancer Markers Detection by Capacitance Biochip.
Carrara S, Bhalla V, Stagni C, Benini L, Ferretti A, Valle F, Gallotta A, Ricco B, Samori B.
Sensors and Actuators B: Chemical 2008 Oct; 136(1):163.
Application：Array, ELISA, Human, Serum from patients with hepatocellular carcinoma.
-
Label-Free Cancer Markers Detection by Capacitance Biochip.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com