Product Browser

Last updated: 2014/7/28

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RAD1 monoclonal antibody (M01A), clone 1G2

  • Catalog # : H00005810-M01A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant RAD1.
  • Immunogen:
  • RAD1 (AAH06837, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MPLLTQQIQDEDDQYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQANAFIQAGIFQEFKVQEESVTFRINLTVLL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG3 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005810-M01A
    Western Blot detection against Immunogen (35.53 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of RAD1 expression in transfected 293T cell line by RAD1 monoclonal antibody (M01A), clone 1G2.

    Lane 1: RAD1 transfected lysate(32.43 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5810
  • Gene Name:
  • RAD1
  • Gene Alias:
  • HRAD1,REC1
  • Gene Description:
  • RAD1 homolog (S. pombe)
  • Gene Summary:
  • This gene encodes a component of a heterotrimeric cell cycle checkpoint complex, known as the 9-1-1 complex, that is activated to stop cell cycle progression in response to DNA damage or incomplete DNA replication. The 9-1-1 complex is recruited by RAD17 to affected sites where it may attract specialized DNA polymerases and other DNA repair effectors. Alternatively spliced transcript variants of this gene have been described. [provided by RefSeq
  • Other Designations:
  • DNA repair exonuclease REC1,OTTHUMP00000115992,RAD1 homolog,Rad1-like DNA damage checkpoint,cell cycle checkpoint protein Hrad1,checkpoint control protein HRAD1,exonuclease homolog RAD1
  • RSS
  • YouTube
  • Linkedin
  • Facebook