Product Browser

Last updated: 2014/7/28
  • Related Product Showcase

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PTH monoclonal antibody (M14), clone 3E7

  • Catalog # : H00005741-M14
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant PTH.
  • Immunogen:
  • PTH (NP_000306, 32 a.a.-115 a.a.) full-length recombinant protein.
  • Sequence:
  • SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PTH expression in transfected 293T cell line by PTH monoclonal antibody (M14), clone 3E7.

    Lane 1: PTH transfected lysate(12.9 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5741
  • GeneBank Accession#:
  • N/A
  • Protein Accession#:
  • -
  • Gene Name:
  • PTH
  • Gene Alias:
  • PTH1
  • Gene Description:
  • parathyroid hormone
  • Gene Summary:
  • The protein encoded by this gene is a hormone secreted by parathyroid cells. This hormone elevates blood Ca2+ level by dissolving the salts in bone and preventing their renal excretion. Defects in this gene are a cause of familial isolated hypoparathyroidism (FIH). [provided by RefSeq
  • Other Designations:
  • parathormone,parathyrin,parathyroid hormone 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook