Product Browser

Last updated: 2014/10/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MAPK8 monoclonal antibody (M06), clone 4A11

  • Catalog # : H00005599-M06
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant MAPK8.
  • Immunogen:
  • MAPK8 (NP_620637, 318 a.a. ~ 427 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • HPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEVMDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAAGPLGCCR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005599-M06
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of MAPK8 expression in transfected 293T cell line by MAPK8 monoclonal antibody (M06), clone 4A11.

    Lane 1: MAPK8 transfected lysate(48.3 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of MAPK8 transfected lysate using anti-MAPK8 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with MAPK8 MaxPab rabbit polyclonal antibody.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5599
  • Gene Name:
  • MAPK8
  • Gene Alias:
  • JNK,JNK1,JNK1A2,JNK21B1/2,PRKM8,SAPK1
  • Gene Description:
  • mitogen-activated protein kinase 8
  • Gene Summary:
  • The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various cell stimuli, and targets specific transcription factors, and thus mediates immediate-early gene expression in response to cell stimuli. The activation of this kinase by tumor-necrosis factor alpha (TNF-alpha) is found to be required for TNF-alpha induced apoptosis. This kinase is also involved in UV radiation induced apoptosis, which is thought to be related to cytochrom c-mediated cell death pathway. Studies of the mouse counterpart of this gene suggested that this kinase play a key role in T cell proliferation, apoptosis and differentiation. Four alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
  • Other Designations:
  • JNK1 alpha protein kinase,JNK1 beta protein kinase,JUN N-terminal kinase,OTTHUMP00000019552,OTTHUMP00000019555,OTTHUMP00000019556,OTTHUMP00000019558,c-Jun N-terminal kinase 1,mitogen-activated protein kinase 8 isoform JNK1 alpha1,mitogen-activated protein
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook