PDGFRB monoclonal antibody (M08), clone 4C12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
PDGFRB monoclonal antibody (M08), clone 4C12. Western Blot analysis of PDGFRB expression in human stomach.
Western Blot (Tissue lysate)
PDGFRB monoclonal antibody (M08), clone 4C12. Western Blot analysis of PDGFRB expression in human uterus myoma.
Immunoprecipitation
Immunoprecipitation of PDGFRB transfected lysate using anti-PDGFRB monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PDGFRB MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PDGFRB is approximately 1ng/ml as a capture antibody.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between STAT1 and PDGFRB. Mahlavu cells were stained with anti-STAT1 rabbit purified polyclonal 1:1200 and anti-PDGFRB mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PDGFRB.
Immunogen
PDGFRB (AAH32224, 33 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LVVTPPGPELVLNVSSTFVLTCSGSAPVVWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFVPDPTVGFLPNDAE
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PDGFRB monoclonal antibody (M08), clone 4C12. Western Blot analysis of PDGFRB expression in human stomach.Western Blot (Tissue lysate)
PDGFRB monoclonal antibody (M08), clone 4C12. Western Blot analysis of PDGFRB expression in human uterus myoma.Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of PDGFRB transfected lysate using anti-PDGFRB monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PDGFRB MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PDGFRB is approximately 1ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between STAT1 and PDGFRB. Mahlavu cells were stained with anti-STAT1 rabbit purified polyclonal 1:1200 and anti-PDGFRB mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — PDGFRB
Entrez GeneID
5159GeneBank Accession#
BC032224Protein Accession#
AAH32224Gene Name
PDGFRB
Gene Alias
CD140B, JTK12, PDGF-R-beta, PDGFR, PDGFR1
Gene Description
platelet-derived growth factor receptor, beta polypeptide
Gene Ontology
HyperlinkGene Summary
This gene encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. These growth factors are mitogens for cells of mesenchymal origin. The identity of the growth factor bound to a receptor monomer determines whether the functional receptor is a homodimer or a heterodimer, composed of both platelet-derived growth factor receptor alpha and beta polypeptides. This gene is flanked on chromosome 5 by the genes for granulocyte-macrophage colony-stimulating factor and macrophage-colony stimulating factor receptor; all three genes may be implicated in the 5-q syndrome. A translocation between chromosomes 5 and 12, that fuses this gene to that of the translocation, ETV6, leukemia gene, results in chronic myeloproliferative disorder with eosinophilia. [provided by RefSeq
Other Designations
beta platelet-derived growth factor receptor|platelet-derived growth factor receptor beta|soluble PDGFRb variant 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com