PCNA monoclonal antibody (M10), clone 2E9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant PCNA.
Immunogen
PCNA (NP_002583, 78 a.a. ~ 177 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGN
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PCNA is approximately 0.3ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CDK2 and PCNA. Mahlavu cells were stained with anti-CDK2 rabbit purified polyclonal 1:1200 and anti-PCNA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to PCNA on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — PCNA
Entrez GeneID
5111GeneBank Accession#
NM_002592Protein Accession#
NP_002583Gene Name
PCNA
Gene Alias
MGC8367
Gene Description
proliferating cell nuclear antigen
Omim ID
176740Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage, this protein is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for this gene. Pseudogenes of this gene have been described on chromosome 4 and on the X chromosome. [provided by RefSeq
Other Designations
DNA polymerase delta auxiliary protein|OTTHUMP00000030189|OTTHUMP00000030190|cyclin
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com