SLC11A2 monoclonal antibody (M01), clone 4C6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SLC11A2.
Immunogen
SLC11A2 (NP_000608, 1 a.a. ~ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (75); Rat (75)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (32.89 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SLC11A2 on formalin-fixed paraffin-embedded human endometrium cancer. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SLC11A2 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — SLC11A2
Entrez GeneID
4891GeneBank Accession#
NM_000617Protein Accession#
NP_000608Gene Name
SLC11A2
Gene Alias
DCT1, DMT1, FLJ37416, NRAMP2
Gene Description
solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2
Gene Ontology
HyperlinkGene Summary
The SLC11A2 gene encodes a divalent metal transporter (DMT1), which carries iron, manganese, cobalt, nickel, cadmium, lead, copper, and zinc. DMT1 participates in cellular iron absorption at the luminal surface of the duodenum as well as in other areas of the body (Hubert and Hentze, 2002 [PubMed 12209011]; Ludwiczek et al., 2007 [PubMed 17293870]).[supplied by OMIM
Other Designations
natural resistance-associated macrophage protein 2
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Defective palmitoylation of transferrin receptor triggers iron overload in Friedreich's ataxia fibroblasts.
Floriane Petit, Anthony Drecourt, Michaël Dussiot, Coralie Zangarelli, Olivier Hermine, Arnold Munnich, Agnes Rotig.
Blood 2021 Apr; 137(15):2090.
Application:IP-WB, Human, Human skin fibroblasts.
-
Maternal protein restriction depresses the duodenal expression of iron transporters and serum iron level in male weaning piglets.
Ma W, Lu J, Jiang S, Cai D, Pan S, Jia Y, Zhao R.
The British Journal of Nutrition 2017 Apr; 117(7):923.
Application:WB-Ti, Pig, Pig duodenal mucosa.
-
Discovery and characterization of a novel non-competitive inhibitor of the divalent metal transporter DMT1/SLC11A2.
Montalbetti N, Simonin A, Simonin C, Awale M, Reymond JL, Hediger MA.
Biochemical Pharmacology 2015 Aug; 96(3):216.
Application:WB-Tr, Human, HEK 293 cells.
-
Development and Validation of a Fast and Homogeneous Cell-Based Fluorescence Screening Assay for Divalent Metal Transporter 1 (DMT1/SLC11A2) Using the FLIPR Tetra.
Montalbetti N, Simonin A, Dalghi MG, Kovacs G, Hediger MA.
Journal of Biomolecular Screening 2014 Jul; 19(6):900.
Application:WB, Human, HEK293 cells.
-
Divalent metal transporter 1 (DMT1) regulation by Ndfip1 prevents metal toxicity in human neurons.
Howitt J, Putz U, Lackovic J, Doan A, Dorstyn L, Cheng H, Yang B, Chan-Ling T, Silke J, Kumar S, Tan SS.
PNAS 2009 Sep; 106(36):15489.
Application:IF, IP, WB, Human, Human brain, primary neurons, SH-SY5Y cells.
-
Regulation of the divalent metal ion transporter DMT1 and iron homeostasis by a ubiquitin-dependent mechanism involving Ndfips and WWP2.
Foot NJ, Dalton HE, Shearwin-Whyatt LM, Dorstyn L, Tan SS, Yang B, Kumar S.
Blood 2008 Sep; 112(10):4268.
Application:WB, Human, Mouse, CHO cells, Mouse liver.
-
Defective palmitoylation of transferrin receptor triggers iron overload in Friedreich's ataxia fibroblasts.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com