NPPB (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human NPPB full-length ORF ( AAH25785, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDSETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
40.48
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — NPPB
Entrez GeneID
4879GeneBank Accession#
BC025785Protein Accession#
AAH25785Gene Name
NPPB
Gene Alias
BNP
Gene Description
natriuretic peptide precursor B
Omim ID
600295Gene Ontology
HyperlinkGene Summary
This gene is a member of the natriuretic peptide family and encodes a secreted protein which functions as a cardiac hormone. The protein undergoes two cleavage events, one within the cell and a second after secretion into the blood. The protein's biological actions include natriuresis, diuresis, vasorelaxation, inhibition of renin and aldosterone secretion, and a key role in cardiovascular homeostasis. A high concentration of this protein in the bloodstream is indicative of heart failure. Mutations in this gene have been associated with postmenopausal osteoporosis. [provided by RefSeq
Other Designations
OTTHUMP00000002506|OTTHUMP00000044486|brain type natriuretic peptide|natriuretic protein
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
BNP directly immunoregulates the innate immune system of cardiac transplant recipients in vitro.
Shaw SM, Fildes JE, Puchalka CM, Basith M, Yonan N, Williams SG.
Transplant Immunology 2008 Sep; 20(3):199.
Application:Func, Human, PBMCs from cardiac transplant recipients.
-
BNP directly immunoregulates the innate immune system of cardiac transplant recipients in vitro.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com