MUC4 monoclonal antibody (M07), clone 5B12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
MUC4 monoclonal antibody (M07), clone 5B12 Western Blot analysis of MUC4 expression in HeLa ( Cat # L013V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MUC4 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MUC4 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MUC4.
Immunogen
MUC4 (NP_004523, 79 a.a. ~ 188 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GVSLFPYGADAGDLEFVRRTVDFTSPLFKPATGFPLGSSLRDSLYFTDNGQIIFPESDYQIFSYPNPLPTGFTGRDPVALVAPFWDDADFSTGRGTTFYQEYETFYGEHS
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MUC4 monoclonal antibody (M07), clone 5B12 Western Blot analysis of MUC4 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MUC4 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MUC4 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — MUC4
Entrez GeneID
4585GeneBank Accession#
NM_004532Protein Accession#
NP_004523Gene Name
MUC4
Gene Alias
HSA276359
Gene Description
mucin 4, cell surface associated
Omim ID
158372Gene Ontology
HyperlinkGene Summary
The major constituents of mucus, the viscous secretion that covers epithelial surfaces such as those in the trachea, colon, and cervix, are highly glycosylated proteins called mucins. These glycoproteins play important roles in the protection of the epithelial cells and have been implicated in epithelial renewal and differentiation. This gene encodes an integral membrane glycoprotein found on the cell surface, although secreted isoforms may exist. At least two dozen transcript variants of this gene have been found, although for many of them the full-length transcript has not been determined or they are found only in tumor tissues. This gene contains a region in the coding sequence which has a variable number (>100) of 48 nt tandem repeats. [provided by RefSeq
Other Designations
mucin 4|mucin 4, tracheobronchial
-
Interactome
-
Disease
-
Publication Reference
-
Effect of a Semi-Purified Oligosaccharide-Enriched Fraction from Caprine Milk on Barrier Integrity and Mucin Production of Co-Culture Models of the Small and Large Intestinal Epithelium.
Barnett AM, Roy NC, McNabb WC, Cookson AL.
Nutrients 2016 May; 8(5):267.
Application：ELISA, Human, Supernatant obtained from Caco-2:HT29-MTX cultures medium.
-
Expression of MUC1 and MUC4 in gallbladder adenocarcinoma.
Kim SM, Oh SJ, Hur B.
Korean Journal of Pathology 2012 Oct; 46(5):429.
Application：IHC-P, Human, Human gallbladder adenocarcinoma.
-
Identification of a novel type of CA19-9 carrier molecules in human bile and sera of cancer patients: An implication of the involvement in non-secretory exocytosis.
Uozumi N, Gao C, Yoshioka T, Nakano M, Moriwaki K, Nakagawa T, Masuda T, Tanabe M, Miyoshi E.
Journal of Proteome Research 2010 Dec; 9(12):6345.
Application：WB-Ti, Human, Human cholangiocarcinomas .
-
Establishment and characterization of a new human pancreatic adenocarcinoma cell line with high metastatic potential to the lung.
Kalinina T, Gungor C, Thieltges S, Moller-Krull M, Murga Penas EM, Wicklein D, Streichert T, Schumacher U, Kalinin V, Simon R, Otto B, Dierlamm J, Schwarzenbach H, Effenberger KE, Bockhorn M, Izbicki JR, Yekebas EF.
BMC Cancer 2010 Jun; 10:295.
Application：IHC-P, Human, Mouse, Lungs, PaCa 5061 cells, Pancreatic adenocarcinoma.
-
Isolation and identification of potential urinary microparticle biomarkers of bladder cancer.
Smalley DM, Sheman NE, Nelson K, Theodorescu D.
Journal of Proteome Research 2008 Mar; 7(5):2088.
Application：WB, Human, Urine microparticles from healthy controls and individuals with bladder cancer.
-
Effect of a Semi-Purified Oligosaccharide-Enriched Fraction from Caprine Milk on Barrier Integrity and Mucin Production of Co-Culture Models of the Small and Large Intestinal Epithelium.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com