LIPA purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
LIPA MaxPab rabbit polyclonal antibody. Western Blot analysis of LIPA expression in K-562.
Western Blot (Transfected lysate)
Western Blot analysis of LIPA expression in transfected 293T cell line (H00003988-T01) by LIPA MaxPab polyclonal antibody.
Lane 1: LIPA transfected lysate(45.40 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human LIPA protein.
Immunogen
LIPA (AAH12287.1, 1 a.a. ~ 399 a.a) full-length human protein.
Sequence
MKMRFLGLVVCLVLWPLHSEGSGGKLTALDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (74); Rat (76)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
LIPA MaxPab rabbit polyclonal antibody. Western Blot analysis of LIPA expression in K-562.Western Blot (Transfected lysate)
Western Blot analysis of LIPA expression in transfected 293T cell line (H00003988-T01) by LIPA MaxPab polyclonal antibody.
Lane 1: LIPA transfected lysate(45.40 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — LIPA
Entrez GeneID
3988GeneBank Accession#
BC012287.1Protein Accession#
AAH12287.1Gene Name
LIPA
Gene Alias
CESD, LAL
Gene Description
lipase A, lysosomal acid, cholesterol esterase
Omim ID
278000Gene Ontology
HyperlinkGene Summary
This gene encodes lipase A, the lysosomal acid lipase (also known as cholesterol ester hydrolase). This enzyme functions in the lysosome to catalyze the hydrolysis of cholesteryl esters and triglycerides. Mutations in this gene can result in Wolman disease and cholesteryl ester storage disease. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000020066|OTTHUMP00000020068|OTTHUMP00000059643|cholesterol ester hydrolase|lipase A|lysosomal acid lipase|sterol esterase
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Characterization of the Niemann-Pick C pathway in alveolar type II cells and lamellar bodies of the lung.
Roszell BR, Tao JQ, Yu KJ, Huang S, Bates SR.
American Journal of Physiology. Lung Cellular and Molecular Physiology 2012 May; 302(9):L919.
Application：IF, WB, Rat, Rat alveolar type II cells, Lung tissues.
-
Characterization of the Niemann-Pick C pathway in alveolar type II cells and lamellar bodies of the lung.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com