Product Browser

Last updated: 2014/12/14
  • Related Product Showcase
  • By Hot Target

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LIF (Human) Recombinant Protein (P01)

  • Catalog # : H00003976-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human LIF full-length ORF ( NP_002300.1, 1 a.a. - 202 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 48.4
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003976-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3976
  • Gene Name:
  • LIF
  • Gene Alias:
  • CDF,DIA,HILDA
  • Gene Description:
  • leukemia inhibitory factor (cholinergic differentiation factor)
  • Gene Summary:
  • The protein encoded by this gene is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface. [provided by RefSeq
  • Other Designations:
  • D factor,cholinergic differentiation factor,differentiation inhibitory activity,differentiation stimulating factor
  • RSS
  • YouTube
  • Linkedin
  • Facebook