Product Browser
 
  • Related Product Showcase
  • By Research Area
  • By Disease
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

KCNJ11 polyclonal antibody (A01)   

  • Catalog # : H00003767-A01
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 50 uL
  • USD $ 229
  • Stock Image
  • order now, ship next day
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant KCNJ11.
  • Immunogen:
  • KCNJ11 (NP_000516, 301 a.a. ~ 390 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTVKVPTPLCTARQLDEDHSLLEALTLASARGPLRKRSVPMAKAKPKFSISPDSLS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003767-A01
    Western Blot detection against Immunogen (36.01 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • KCNJ11 polyclonal antibody (A01), Lot # 051024JC01 Western Blot analysis of KCNJ11 expression in HL-60 ( Cat # L014V1 ).
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3767
  • Gene Name:
  • KCNJ11
  • Gene Alias:
  • BIR,HHF2,IKATP,KIR6.2,MGC133230,PHHI,TNDM3
  • Gene Description:
  • potassium inwardly-rectifying channel, subfamily J, member 11
  • Gene Summary:
  • Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins and is found associated with the sulfonylurea receptor SUR. Mutations in this gene are a cause of familial persistent hyperinsulinemic hypoglycemia of infancy (PHHI), an autosomal recessive disorder characterized by unregulated insulin secretion. Defects in this gene may also contribute to autosomal dominant non-insulin-dependent diabetes mellitus type II (NIDDM), transient neonatal diabetes mellitus type 3 (TNDM3), and permanent neonatal diabetes mellitus (PNDM). [provided by RefSeq
  • Other Designations:
  • ATP-sensitive inward rectifier potassium channel 11,beta-cell inward rectifier subunit,inwardly rectifying potassium channel KIR6.2,potassium inwardly-rectifying channel J11
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!