KCNA3 monoclonal antibody (M01), clone 1D8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
KCNA3 monoclonal antibody (M01), clone 1D8. Western Blot analysis of KCNA3 expression in human liver.
Western Blot (Cell lysate)
KCNA3 monoclonal antibody (M01), clone 1D8 Western Blot analysis of KCNA3 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Cell lysate)
KCNA3 monoclonal antibody (M01), clone 1D8. Western Blot analysis of KCNA3 expression in Jurkat.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KCNA3 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant KCNA3.
Immunogen
KCNA3 (AAH35059, 424 a.a. ~ 523 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VPVIVSNFNYFYHRETEGEEQSQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (99)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
KCNA3 monoclonal antibody (M01), clone 1D8. Western Blot analysis of KCNA3 expression in human liver.Western Blot (Cell lysate)
KCNA3 monoclonal antibody (M01), clone 1D8 Western Blot analysis of KCNA3 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
KCNA3 monoclonal antibody (M01), clone 1D8. Western Blot analysis of KCNA3 expression in Jurkat.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KCNA3 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — KCNA3
Entrez GeneID
3738GeneBank Accession#
BC035059Protein Accession#
AAH35059Gene Name
KCNA3
Gene Alias
HGK5, HLK3, HPCN3, HUKIII, KV1.3, MK3, PCN3
Gene Description
potassium voltage-gated channel, shaker-related subfamily, member 3
Omim ID
176263Gene Ontology
HyperlinkGene Summary
Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. It plays an essential role in T-cell proliferation and activation. This gene appears to be intronless and it is clustered together with KCNA2 and KCNA10 genes on chromosome 1. [provided by RefSeq
Other Designations
OTTHUMP00000032397|potassium channel 3|type n potassium channel|voltage-gated potassium channel protein Kv1.3
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com