- World's Largest Antibody and Recombinant Protein Manufacturer
- | Home
- | Contact Us
- Products
- Services
- Support
- Connection
- About us
 |
 |
-
- DNA & RNA (46)
- siRNA/Chimera (15364)
- Proteins/Peptides (25865)
- MaxPab® Ab (16217)
- Monoclonal Ab (21396)
- Polyclonal Ab (27483)
- Conjugate Ab/Beads (1328)
- Secondary/Tag Ab (1005)
- Lysates/Slides (9167)
- Ab Pairs/Kits (7698)
- Ab Array Det Kits (1)
- Ab Concentration Kits (1)
- Ab Labeling Kits (40)
- Ab Pairs for ELISA (1352)
- Ab Pairs for IP-WB (2015)
- Ab Pairs for PP (259)
- Ab Pairs for PPI (606)
- Ab Purification Kits (3)
- Assay Kits (521)
- Cell-Based ELISA Kits (708)
- CLIA Kits (44)
- ELISA Kits (2113)
- IHC Kits (6)
- IP & ChIP Kits (20)
- Mutation Detection Kits (3)
- Protein Expression Kits (6)
- Ab & Tissue Arrays (128)
- IHC/Pathology Ab (17916)
- In Situ Hybridization (1056)
- Circulating Tumor Cell (29)
- Systems (4)
- ASR/IVDiagnostics (21)
- Related Product Showcase
- By Research Area
- By Disease
 |
|
Click this icon to add products to compare list. Select up to 10 products.
- Home > Products > Monoclonal Ab > Human > Membrane > Ion Channel > KCNA3 monoclonal antibody (M01), clone 1D8
KCNA3 monoclonal antibody (M01), clone 1D8
- Catalog # : H00003738-M01
- Visit Frequency :
- Size
- Price
- In Stock
- Availability
- Cart
- 100 ug
- USD $ 319
- order now, ship next day
-
-
- The price is valid only in USA. Please select country.
- Ask us anything
- Payment Information
Credit card :
or Purchase Order Number
Email : sales@abnova.com
Phone : +1-909-992-0619 (new)
Fax : +1-909-992-3401- Products will be shipped directly to the customer.
- Specification
- Product Description:
- Mouse monoclonal antibody raised against a partial recombinant KCNA3.
- Immunogen:
- KCNA3 (AAH35059, 424 a.a. ~ 523 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Sequence:
- VPVIVSNFNYFYHRETEGEEQSQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV
- Host:
- Mouse
- Reactivity:
- Human
- Isotype:
- IgG1 Kappa
- Quality Control Testing:
- Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
- Storage Buffer:
- In 1x PBS, pH 7.2
- Storage Instruction:
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- MSDS:
Download
- Applications
- Western Blot (Tissue lysate)
- KCNA3 monoclonal antibody (M01), clone 1D8. Western Blot analysis of KCNA3 expression in human liver.
- Protocol Download
- Western Blot (Cell lysate)
- KCNA3 monoclonal antibody (M01), clone 1D8 Western Blot analysis of KCNA3 expression in HeLa NE ( Cat # L013V3 ).
- Protocol Download
- Western Blot (Cell lysate)
- KCNA3 monoclonal antibody (M01), clone 1D8. Western Blot analysis of KCNA3 expression in Jurkat.
- Protocol Download
- Western Blot (Recombinant protein)
- Protocol Download
- Sandwich ELISA (Recombinant protein)
- Detection limit for recombinant GST tagged KCNA3 is approximately 0.03ng/ml as a capture antibody.
- Protocol Download
- Entrez GeneID:
- 3738
- GeneBank Accession#:
- BC035059
- Protein Accession#:
- AAH35059
- Gene Name:
- KCNA3
- Gene Alias:
- HGK5,HLK3,HPCN3,HUKIII,KV1.3,MK3,PCN3
- Gene Description:
- potassium voltage-gated channel, shaker-related subfamily, member 3
- Omim ID:
- 176263
- Gene Ontology:
- Hyperlink
- Gene Summary:
- Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. It plays an essential role in T-cell proliferation and activation. This gene appears to be intronless and it is clustered together with KCNA2 and KCNA10 genes on chromosome 1. [provided by RefSeq
- Other Designations:
- OTTHUMP00000032397,potassium channel 3,type n potassium channel,voltage-gated potassium channel protein Kv1.3
- Related Disease
