IL10 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human IL10 protein.
Immunogen
IL10 (AAI04253.1, 1 a.a. ~ 178 a.a) full-length human protein.
Sequence
MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (73); Rat (74)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
IL10 MaxPab rabbit polyclonal antibody. Western Blot analysis of IL10 expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of IL10 expression in transfected 293T cell line (H00003586-T01) by IL10 MaxPab polyclonal antibody.
Lane 1: IL10 transfected lysate(20.50 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between IL10 and A2M. HeLa cells were stained with anti-IL10 rabbit purified polyclonal 1:1200 and anti-A2M mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — IL10
Entrez GeneID
3586GeneBank Accession#
NM_000572Protein Accession#
AAI04253.1Gene Name
IL10
Gene Alias
CSIF, IL-10, IL10A, MGC126450, MGC126451, TGIF
Gene Description
interleukin 10
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway. Knockout studies in mice suggested the function of this cytokine as an essential immunoregulator in the intestinal tract. [provided by RefSeq
Other Designations
cytokine synthesis inhibitory factor
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com