GCLC monoclonal antibody (M01), clone 3H1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GCLC.
Immunogen
GCLC (NP_001489, 528 a.a. ~ 637 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EGVFPGLIPILNSYLENMEVDVDTRCSILNYLKLIKKRASGELMTVARWMREFIANHPDYKQDSVITDEMNYSLILKCNQIANELCECPELLGSAFRKVKYSGSKTDSSN
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GCLC monoclonal antibody (M01), clone 3H1. Western Blot analysis of GCLC expression in PC-12.Western Blot (Cell lysate)
GCLC monoclonal antibody (M01), clone 3H1. Western Blot analysis of GCLC expression in NIH/3T3.Western Blot (Cell lysate)
GCLC monoclonal antibody (M01), clone 3H1 Western Blot analysis of GCLC expression in A-431 ( Cat # L015V1 ).Western Blot (Transfected lysate)
Western Blot analysis of GCLC expression in transfected 293T cell line by GCLC monoclonal antibody (M01), clone 3H1.
Lane 1: GCLC transfected lysate(72.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GCLC is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to GCLC on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — GCLC
Entrez GeneID
2729GeneBank Accession#
NM_001498Protein Accession#
NP_001489Gene Name
GCLC
Gene Alias
GCS, GLCL, GLCLC
Gene Description
glutamate-cysteine ligase, catalytic subunit
Gene Ontology
HyperlinkGene Summary
Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. The gene encoding the catalytic subunit encodes a protein of 367 amino acids with a calculated molecular weight of 72.773 kDa and maps to chromosome 6. The regulatory subunit is derived from a different gene located on chromosome 1p22-p21. Deficiency of gamma-glutamylcysteine synthetase in human is associated with enzymopathic hemolytic anemia. [provided by RefSeq
Other Designations
gamma-glutamylcysteine synthetase
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Polysulfide protects midbrain dopaminergic neurons from MPP+-induced degeneration via enhancement of glutathione biosynthesis.
Takahashi S, Hisatsune A, Kurauchi Y, Seki T, Katsuki H.
Journal of Pharmacological Sciences 2018 May; 137(1):47.
Application:WB, Human, Rat, C6, SH-SY5Y cells.
-
Insulin-like growth factor 1 specifically up-regulates expression of modifier subunit of glutamate-cysteine ligase and enhances glutathione synthesis in SH-SY5Y cells.
Takahashi S, Hisatsune A, Kurauchi Y, Seki T, Katsuki H.
European Journal of Pharmacology 2016 Jan; 771:99.
Application:WB, Human, SH-SY5Y cells.
-
Glycogen Synthase Kinase 3 Regulates Cell Death and Survival Signaling in Tumor Cells under Redox Stress.
Vene R, Cardinali B, Arena G, Ferrari N, Benelli R, Minghelli S, Poggi A, Noonan DM, Albini A, Tosetti F.
Neoplasia 2014 Sep; 16(9):710.
Application:WB-Ce, Human, PC3, DU145 cells.
-
Prominent steatosis with hypermetabolism of the cell line permissive for years of infection with hepatitis C virus.
Sugiyama K, Ebinuma H, Nakamoto N, Sakasegawa N, Murakami Y, Chu PS, Usui S, Ishibashi Y, Wakayama Y, Taniki N, Murata H, Saito Y, Fukasawa M, Saito K, Yamagishi Y, Wakita T, Takaku H, Hibi T, Saito H, Kanai T.
PLoS One 2014 Apr; 9(4):e94460.
Application:WB-Ce, Human, Huh7.5, HPI, CuHuh7.5, CuHPI cells.
-
The LEGSKO mouse: a mouse model of age-related nuclear cataract based on genetic suppression of lens glutathione synthesis.
Fan X, Liu X, Hao S, Wang B, Robinson ML, Monnier VM.
PLoS One 2012 Nov; 7(11):e50832.
Application:WB-Ti, Mouse, Liver, Lens.
-
Differential activation of the inflammasome in THP-1 cells exposed to chrysotile asbestos and Libby "six-mix" amphiboles and subsequent activation of BEAS-2B cells.
Li M, Gunter ME, Fukagawa NK.
Cytokine 2012 Dec; 60(3):718.
Application:WB-Ce, Human, THP-2 cells.
-
Protection against 2-chloroethyl ethyl sulfide (CEES) - Induced cytotoxicity in human keratinocytes by an inducer of the glutathione detoxification pathway.
Abel EL, Bubel JD, Simper MS, Powell L, McClellan SA, Andreeff M, Macleod MC, Digiovanni J.
Toxicol Appl Pharmacol 2011 Jun; 255:176.
Application:WB-Ce, Human, NCTC 2544 cells.
-
Diversity in Antioxidant Response Enzymes in Progressive Stages of Human Nonalcoholic Fatty Liver Disease.
Hardwick RN, Fisher CD, Canet MJ, Lake AD, Cherrington NJ.
Drug Metabolism and Disposition 2010 Dec; 38(12):2293.
Application:WB-Ti, Human , Human liver samples.
-
Polysulfide protects midbrain dopaminergic neurons from MPP+-induced degeneration via enhancement of glutathione biosynthesis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com