Product Browser

Last updated: 2014/7/28

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GGT1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00002678-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GGT1 partial ORF (NP_005256, 381 a.a. - 470 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • TAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVG
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.64
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue

    QC Testing of H00002678-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2678
  • Gene Name:
  • GGT1
  • Gene Alias:
  • CD224,D22S672,D22S732,GGT,GTG,MGC96892,MGC96904,MGC96963
  • Gene Description:
  • gamma-glutamyltransferase 1
  • Gene Summary:
  • The enzyme encoded by this gene catalyzes the transfer of the glutamyl moiety of glutathione to a variety of amino acids and dipeptide acceptors. The enzyme is composed of a heavy chain and a light chain, which are derived from a single precursor protein, and is present in tissues involved in absorption and secretion. This enzyme is a member of the gamma-glutamyltransferase protein family, of which many members have not yet been fully characterized and some of which may represent pseudogenes. This gene is classified as type I gamma-glutamyltransferase. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000028921,OTTHUMP00000159078,gamma-glutamyl transpeptidase,glutamyl transpeptidase
  • RSS
  • YouTube
  • Linkedin
  • Facebook