Product Browser

Last updated: 2014/9/1
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GFRA1 monoclonal antibody (M05), clone 4D8

  • Catalog # : H00002674-M05
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full length recombinant GFRA1.
  • Immunogen:
  • GFRA1 (NP_005255, 32 a.a. ~ 119 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • ASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKDECRSAMEALKQKSLYNCRCKRGMKKEKNCLRIYWSMYQSLQGNDLLEDS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2674
  • Gene Name:
  • GFRA1
  • Gene Alias:
  • GDNFR,GDNFRA,GFR-ALPHA-1,MGC23045,RET1L,RETL1,TRNR1
  • Gene Description:
  • GDNF family receptor alpha 1
  • Gene Summary:
  • Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. The protein encoded by this gene is a member of the GDNF receptor family. It is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This gene is a candidate gene for Hirschsprung disease. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq
  • Other Designations:
  • GPI-linked anchor protein,Glial cell line-derived neurotrophic factor receptor alpha,OTTHUMP00000020558,OTTHUMP00000020559,PI-linked cell-surface accessory protein,RET ligand 1,TGF-beta related neurotrophic factor receptor 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook